Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3166
Gene name
LocationContig_203:16714..17242
Strand+
Gene length (bp)528
Transcript length (bp)528
Coding sequence length (bp)528
Protein length (aa) 176

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08636 Pkr1 ER protein Pkr1 2.2E-28 2 72

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9P7Y3|PKR1_SCHPO V-type ATPase assembly factor pkr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pkr1 PE=3 SV=1 3 75 1.0E-09
sp|Q03880|PKR1_YEAST V-type ATPase assembly factor PKR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PKR1 PE=1 SV=1 1 70 6.0E-09

GO

GO Term Description Terminal node
GO:0070072 vacuolar proton-transporting V-type ATPase complex assembly Yes
GO:0071840 cellular component organization or biogenesis No
GO:0009987 cellular process No
GO:0008150 biological_process No
GO:0016043 cellular component organization No
GO:0070071 proton-transporting two-sector ATPase complex assembly No
GO:0070070 proton-transporting V-type ATPase complex assembly No
GO:0043933 protein-containing complex organization No
GO:0065003 protein-containing complex assembly No
GO:0022607 cellular component assembly No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.5

Transmembrane Domains

Domain # Start End Length
1 20 42 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3166
MASFLTNLFNSIFVPGPTPTLLRAANTTFAALQLVLAVLLVVTRSVHFIILSVLCAALWRAINWFAAELAAADAD
AAAAAPSSSSSAAPAAASSSSRYSDSASEGQHLHRVHHQHSSDSDTEVERGAHVSGPAAVRRRAAAALPTQGSDA
ALSQSSASTEDEWEKVSTGDRDKLK*
Coding >OphauB2|3166
ATGGCATCCTTTCTAACCAACCTCTTCAACTCCATCTTCGTCCCCGGCCCTACCCCTACCCTCCTCCGCGCCGCA
AACACAACCTTTGCCGCCCTTCAACTCGTCCTTGCCGTCCTCCTCGTCGTCACGCGGAGCGTCCACTTCATCATT
CTCTCTGTTCTCTGCGCTGCGCTATGGCGCGCCATCAACTGGTTTGCTGCAGAGCTCGCCGCTGCTGATGCTGAT
GCTGCGGCTGCTGCCCCTTCTTCCTCCTCCTCGGCTGCCCCTGCTGCTGCGTCGTCGTCGTCGCGCTACTCCGAC
TCGGCTTCAGAGGGACAGCATCTTCACCGCGTACACCACCAGCACTCGAGCGATAGTGACACCGAGGTGGAGCGC
GGTGCACATGTTTCTGGCCCGGCTGCCGTTCGACGGCGCGCTGCTGCTGCGTTGCCCACACAGGGCTCTGATGCC
GCCCTCTCGCAGTCAAGTGCGAGCACAGAGGACGAGTGGGAAAAGGTGTCGACTGGGGATAGAGACAAGCTAAAG
TAA
Transcript >OphauB2|3166
ATGGCATCCTTTCTAACCAACCTCTTCAACTCCATCTTCGTCCCCGGCCCTACCCCTACCCTCCTCCGCGCCGCA
AACACAACCTTTGCCGCCCTTCAACTCGTCCTTGCCGTCCTCCTCGTCGTCACGCGGAGCGTCCACTTCATCATT
CTCTCTGTTCTCTGCGCTGCGCTATGGCGCGCCATCAACTGGTTTGCTGCAGAGCTCGCCGCTGCTGATGCTGAT
GCTGCGGCTGCTGCCCCTTCTTCCTCCTCCTCGGCTGCCCCTGCTGCTGCGTCGTCGTCGTCGCGCTACTCCGAC
TCGGCTTCAGAGGGACAGCATCTTCACCGCGTACACCACCAGCACTCGAGCGATAGTGACACCGAGGTGGAGCGC
GGTGCACATGTTTCTGGCCCGGCTGCCGTTCGACGGCGCGCTGCTGCTGCGTTGCCCACACAGGGCTCTGATGCC
GCCCTCTCGCAGTCAAGTGCGAGCACAGAGGACGAGTGGGAAAAGGTGTCGACTGGGGATAGAGACAAGCTAAAG
TAA
Gene >OphauB2|3166
ATGGCATCCTTTCTAACCAACCTCTTCAACTCCATCTTCGTCCCCGGCCCTACCCCTACCCTCCTCCGCGCCGCA
AACACAACCTTTGCCGCCCTTCAACTCGTCCTTGCCGTCCTCCTCGTCGTCACGCGGAGCGTCCACTTCATCATT
CTCTCTGTTCTCTGCGCTGCGCTATGGCGCGCCATCAACTGGTTTGCTGCAGAGCTCGCCGCTGCTGATGCTGAT
GCTGCGGCTGCTGCCCCTTCTTCCTCCTCCTCGGCTGCCCCTGCTGCTGCGTCGTCGTCGTCGCGCTACTCCGAC
TCGGCTTCAGAGGGACAGCATCTTCACCGCGTACACCACCAGCACTCGAGCGATAGTGACACCGAGGTGGAGCGC
GGTGCACATGTTTCTGGCCCGGCTGCCGTTCGACGGCGCGCTGCTGCTGCGTTGCCCACACAGGGCTCTGATGCC
GCCCTCTCGCAGTCAAGTGCGAGCACAGAGGACGAGTGGGAAAAGGTGTCGACTGGGGATAGAGACAAGCTAAAG
TAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail