Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|315
Gene name
LocationContig_101:68131..71142
Strand-
Gene length (bp)3011
Transcript length (bp)2949
Coding sequence length (bp)2949
Protein length (aa) 983

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06011 TRP Transient receptor potential (TRP) ion channel 8.2E-112 204 718
PF14558 TRP_N ML-like domain 9.0E-38 59 198

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74520|YCPE_SCHPO Uncharacterized membrane protein C663.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC663.14c PE=3 SV=2 59 470 5.0E-41
sp|P39719|FLC2_YEAST Flavin carrier protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLC2 PE=1 SV=2 46 726 2.0E-26
sp|Q08967|FLC1_YEAST Flavin carrier protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLC1 PE=1 SV=1 67 682 2.0E-24
sp|Q08844|YO365_YEAST Uncharacterized membrane protein YOR365C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR365C PE=1 SV=1 69 632 1.0E-22
sp|P53121|FLC3_YEAST Putative flavin carrier protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLC3 PE=1 SV=1 67 692 5.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74520|YCPE_SCHPO Uncharacterized membrane protein C663.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC663.14c PE=3 SV=2 59 470 5.0E-41
sp|P39719|FLC2_YEAST Flavin carrier protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLC2 PE=1 SV=2 46 726 2.0E-26
sp|Q08967|FLC1_YEAST Flavin carrier protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLC1 PE=1 SV=1 67 682 2.0E-24
sp|Q08844|YO365_YEAST Uncharacterized membrane protein YOR365C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR365C PE=1 SV=1 69 632 1.0E-22
sp|P53121|FLC3_YEAST Putative flavin carrier protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLC3 PE=1 SV=1 67 692 5.0E-22
sp|Q09917|PKD2_SCHPO TRP-like ion channel pkd2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pkd2 PE=1 SV=1 71 314 3.0E-11
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 34 0.45

Transmembrane Domains

Domain # Start End Length
1 15 33 18
2 128 150 22
3 205 227 22
4 240 262 22
5 390 412 22
6 433 455 22
7 470 492 22
8 584 606 22
9 610 632 22
10 639 661 22
11 676 698 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|315
MRGGMLRRRSSPPLAAMALLALVLACLTSSALARDQARIKGYGIDGKTRELDVNRYPALYTGDFDDCLGGESLFN
VTKFDAAYYADNLTVLFHLDGSTNIRSENLILHISVEAYGENRFNMTYDPCKANIGSMCPLNASVPVTAFAVIPI
SPTDVAGIPSIALGIPDLEGFARLQIFANSTQTEIGCFQAVMTNGNSFSQPQYVGTIMGVFTLLAVLASFATAIY
GVSITHMRTHYAHSFSLLVIFETFQSIFFSGALTVNWPSVLPAWWSNFAWSAGMFASDIMVRSISSFAGADANIS
QVGGAGSVQINNGGGLSQQIYGRSLAPLLLAERSSASALAPRQSHNASNPYDYTWNGRPRTPGMPMPGTWPGFAG
TLSLVNVPPTEAFMIGFIWFLVVVGIVASFVVSTKFLLDWLIRLKLIKTDGFDFFRSHLPGYLGAALLRTLLIAF
FTMMTLAMYQFSLHGPAGPTAIAAMVWVVFFVGMGGTAAYACRCRLREGSFETTSDKIRVERGTLFNKVPFVVAT
RESSLGHEERRAKRFLISSLPFFRIRYRDRDPYRTNVHQDQGYVKRFGWLAARYRRTRWWFFAVYVGYLFIRACF
LGGGSRTPLAQVFGLFIFEILALVAIIKLSPFEGNRNTAIAVWILSISKIVTTGLSIAFLPDFNLSRIVATVLGI
IIIVVQGFLAVAVLVLIAVGIVSSWMSLSRNRQEFPETLDQTRIQYFEHMQARAADLPRPPRVQVEETQEIRPYF
NVKDVRRAPKIEDEDSQGPAAGLVPGPPSIAGPSSAAASIRRSRANSASSRCSASSLARGTRPHRKSWSSKDFAQ
WDAEMSRGDVQRSRSGSLRLHPIGQDAPRTMVSAARRPPLLTPMRESFEGPMLAMSPASPESPDGKNVSLVVDKI
AESTGPDKAEGASSPQEGTCPQSTASTPEPVDTQEPDVASFSHGSTPAAPLSMETDQPTTSSEPDQGSLANINST
TPENKAS*
Coding >OphauB2|315
ATGCGTGGCGGCATGCTGCGACGACGGTCCTCGCCGCCCCTGGCCGCCATGGCTTTGCTTGCCTTGGTTCTGGCC
TGCCTCACATCATCGGCCCTGGCCCGGGACCAGGCTCGCATCAAGGGCTACGGCATTGATGGCAAGACGCGCGAG
CTCGACGTCAATCGCTACCCGGCCCTCTACACTGGCGACTTTGACGACTGCCTCGGCGGCGAGAGCCTCTTCAAC
GTAACCAAATTCGACGCCGCTTACTATGCCGACAACCTGACGGTCCTCTTCCACCTTGACGGTAGCACAAATATC
CGCAGCGAAAACTTGATTCTCCACATCTCGGTCGAGGCATACGGCGAGAACCGCTTCAACATGACATACGATCCT
TGCAAGGCAAACATTGGCAGCATGTGTCCTCTCAATGCCAGTGTGCCCGTTACTGCCTTTGCCGTGATACCCATC
TCACCAACCGACGTGGCTGGTATCCCGTCCATTGCCCTTGGCATCCCTGACCTGGAAGGCTTTGCCCGCCTCCAA
ATCTTTGCCAACTCGACGCAAACAGAAATCGGCTGCTTTCAAGCCGTCATGACAAATGGCAACTCTTTTTCCCAG
CCCCAGTATGTCGGCACCATCATGGGCGTCTTCACCTTGTTGGCTGTCCTGGCCTCGTTTGCCACAGCAATATAT
GGCGTGAGCATAACGCATATGCGAACTCACTATGCCCATTCCTTTTCCCTTCTTGTCATTTTTGAGACTTTCCAA
TCCATCTTCTTCTCGGGCGCTCTCACGGTCAACTGGCCCAGCGTGCTGCCAGCCTGGTGGAGCAACTTTGCTTGG
TCTGCTGGCATGTTTGCCAGCGATATCATGGTTCGCTCCATAAGCTCATTTGCTGGCGCCGATGCCAACATCAGC
CAGGTTGGCGGAGCAGGCTCTGTGCAAATTAATAATGGAGGGGGTCTATCGCAACAAATCTATGGCCGCTCGCTT
GCCCCCTTGCTCTTGGCAGAGAGGAGCAGTGCATCCGCCCTTGCGCCGCGCCAAAGTCACAATGCGAGCAATCCC
TATGACTACACCTGGAATGGTCGTCCGCGCACTCCGGGAATGCCCATGCCTGGCACTTGGCCAGGCTTTGCCGGC
ACTTTGTCTCTGGTCAACGTGCCCCCAACCGAGGCCTTTATGATAGGCTTCATCTGGTTTCTCGTTGTCGTCGGC
ATCGTTGCTTCCTTTGTTGTCAGCACCAAATTCCTCTTGGACTGGCTGATTCGACTCAAGCTCATCAAGACGGAT
GGATTCGATTTTTTCCGTTCGCATCTGCCAGGCTACCTGGGCGCTGCACTACTTAGGACTCTCTTGATTGCCTTC
TTCACCATGATGACGTTGGCCATGTATCAGTTTTCTCTGCATGGGCCCGCCGGGCCGACTGCCATTGCTGCCATG
GTCTGGGTCGTGTTTTTCGTTGGCATGGGAGGAACAGCTGCATATGCGTGTCGGTGTCGGCTGAGGGAAGGCAGC
TTCGAAACCACTTCTGACAAGATACGCGTGGAGCGTGGCACTCTGTTTAATAAGGTGCCCTTTGTTGTGGCGACG
CGGGAAAGCAGCTTGGGCCATGAAGAGAGGAGGGCCAAGCGCTTTCTCATCAGCTCTCTTCCCTTTTTCAGAATT
CGGTATAGAGACCGAGACCCGTATAGGACCAATGTCCACCAGGACCAGGGCTACGTGAAGCGCTTTGGGTGGCTT
GCAGCTCGTTACCGTCGCACCAGATGGTGGTTTTTTGCTGTATACGTCGGCTACCTTTTCATTAGGGCATGTTTT
CTCGGCGGAGGCTCGCGCACCCCTCTGGCCCAAGTTTTTGGCCTCTTCATCTTTGAGATATTGGCGTTGGTGGCA
ATCATCAAACTGAGCCCCTTTGAGGGTAACCGTAACACGGCAATCGCTGTGTGGATATTGTCGATATCCAAAATC
GTGACAACTGGACTTTCTATTGCATTTTTGCCAGACTTCAACTTGAGCCGCATTGTCGCCACAGTCCTCGGCATT
ATCATCATTGTTGTGCAAGGATTCCTGGCGGTGGCAGTCTTGGTCCTTATTGCTGTGGGCATCGTTTCCTCATGG
ATGTCGCTTTCTCGCAATCGACAAGAGTTTCCCGAGACACTTGACCAGACGCGAATTCAATACTTTGAGCACATG
CAGGCCCGCGCGGCGGATTTGCCCCGGCCGCCCAGAGTGCAAGTTGAAGAGACACAAGAGATTCGGCCCTACTTC
AACGTCAAGGACGTCCGCCGCGCACCCAAGATTGAAGACGAAGACAGCCAAGGCCCGGCTGCGGGACTGGTGCCG
GGTCCGCCCAGCATCGCCGGGCCATCGAGTGCGGCGGCCAGCATTCGGCGCAGCAGGGCCAACAGCGCCAGCTCT
CGCTGCTCTGCGAGCAGTCTTGCCCGGGGCACTCGTCCCCATCGCAAGTCGTGGAGCTCCAAGGATTTCGCGCAG
TGGGACGCCGAGATGAGTCGGGGCGACGTGCAGCGCTCACGCAGCGGATCGCTTCGCTTGCATCCCATTGGTCAA
GATGCTCCGCGCACAATGGTTTCTGCGGCGAGGCGGCCGCCACTGCTGACGCCCATGAGAGAGTCGTTTGAGGGC
CCCATGTTGGCCATGTCGCCAGCATCGCCAGAGTCTCCTGATGGCAAGAATGTCTCTTTGGTCGTGGACAAGATT
GCCGAATCCACGGGCCCAGACAAGGCTGAAGGCGCATCCTCGCCTCAAGAGGGCACATGCCCACAGTCAACTGCA
AGCACGCCTGAGCCTGTTGACACTCAAGAGCCAGATGTGGCGTCTTTTAGCCATGGTTCCACGCCCGCAGCGCCC
TTGTCCATGGAGACAGACCAACCCACCACTAGCTCTGAGCCAGACCAAGGCTCTCTTGCAAATATAAATTCAACA
ACGCCCGAGAATAAGGCGTCTTGA
Transcript >OphauB2|315
ATGCGTGGCGGCATGCTGCGACGACGGTCCTCGCCGCCCCTGGCCGCCATGGCTTTGCTTGCCTTGGTTCTGGCC
TGCCTCACATCATCGGCCCTGGCCCGGGACCAGGCTCGCATCAAGGGCTACGGCATTGATGGCAAGACGCGCGAG
CTCGACGTCAATCGCTACCCGGCCCTCTACACTGGCGACTTTGACGACTGCCTCGGCGGCGAGAGCCTCTTCAAC
GTAACCAAATTCGACGCCGCTTACTATGCCGACAACCTGACGGTCCTCTTCCACCTTGACGGTAGCACAAATATC
CGCAGCGAAAACTTGATTCTCCACATCTCGGTCGAGGCATACGGCGAGAACCGCTTCAACATGACATACGATCCT
TGCAAGGCAAACATTGGCAGCATGTGTCCTCTCAATGCCAGTGTGCCCGTTACTGCCTTTGCCGTGATACCCATC
TCACCAACCGACGTGGCTGGTATCCCGTCCATTGCCCTTGGCATCCCTGACCTGGAAGGCTTTGCCCGCCTCCAA
ATCTTTGCCAACTCGACGCAAACAGAAATCGGCTGCTTTCAAGCCGTCATGACAAATGGCAACTCTTTTTCCCAG
CCCCAGTATGTCGGCACCATCATGGGCGTCTTCACCTTGTTGGCTGTCCTGGCCTCGTTTGCCACAGCAATATAT
GGCGTGAGCATAACGCATATGCGAACTCACTATGCCCATTCCTTTTCCCTTCTTGTCATTTTTGAGACTTTCCAA
TCCATCTTCTTCTCGGGCGCTCTCACGGTCAACTGGCCCAGCGTGCTGCCAGCCTGGTGGAGCAACTTTGCTTGG
TCTGCTGGCATGTTTGCCAGCGATATCATGGTTCGCTCCATAAGCTCATTTGCTGGCGCCGATGCCAACATCAGC
CAGGTTGGCGGAGCAGGCTCTGTGCAAATTAATAATGGAGGGGGTCTATCGCAACAAATCTATGGCCGCTCGCTT
GCCCCCTTGCTCTTGGCAGAGAGGAGCAGTGCATCCGCCCTTGCGCCGCGCCAAAGTCACAATGCGAGCAATCCC
TATGACTACACCTGGAATGGTCGTCCGCGCACTCCGGGAATGCCCATGCCTGGCACTTGGCCAGGCTTTGCCGGC
ACTTTGTCTCTGGTCAACGTGCCCCCAACCGAGGCCTTTATGATAGGCTTCATCTGGTTTCTCGTTGTCGTCGGC
ATCGTTGCTTCCTTTGTTGTCAGCACCAAATTCCTCTTGGACTGGCTGATTCGACTCAAGCTCATCAAGACGGAT
GGATTCGATTTTTTCCGTTCGCATCTGCCAGGCTACCTGGGCGCTGCACTACTTAGGACTCTCTTGATTGCCTTC
TTCACCATGATGACGTTGGCCATGTATCAGTTTTCTCTGCATGGGCCCGCCGGGCCGACTGCCATTGCTGCCATG
GTCTGGGTCGTGTTTTTCGTTGGCATGGGAGGAACAGCTGCATATGCGTGTCGGTGTCGGCTGAGGGAAGGCAGC
TTCGAAACCACTTCTGACAAGATACGCGTGGAGCGTGGCACTCTGTTTAATAAGGTGCCCTTTGTTGTGGCGACG
CGGGAAAGCAGCTTGGGCCATGAAGAGAGGAGGGCCAAGCGCTTTCTCATCAGCTCTCTTCCCTTTTTCAGAATT
CGGTATAGAGACCGAGACCCGTATAGGACCAATGTCCACCAGGACCAGGGCTACGTGAAGCGCTTTGGGTGGCTT
GCAGCTCGTTACCGTCGCACCAGATGGTGGTTTTTTGCTGTATACGTCGGCTACCTTTTCATTAGGGCATGTTTT
CTCGGCGGAGGCTCGCGCACCCCTCTGGCCCAAGTTTTTGGCCTCTTCATCTTTGAGATATTGGCGTTGGTGGCA
ATCATCAAACTGAGCCCCTTTGAGGGTAACCGTAACACGGCAATCGCTGTGTGGATATTGTCGATATCCAAAATC
GTGACAACTGGACTTTCTATTGCATTTTTGCCAGACTTCAACTTGAGCCGCATTGTCGCCACAGTCCTCGGCATT
ATCATCATTGTTGTGCAAGGATTCCTGGCGGTGGCAGTCTTGGTCCTTATTGCTGTGGGCATCGTTTCCTCATGG
ATGTCGCTTTCTCGCAATCGACAAGAGTTTCCCGAGACACTTGACCAGACGCGAATTCAATACTTTGAGCACATG
CAGGCCCGCGCGGCGGATTTGCCCCGGCCGCCCAGAGTGCAAGTTGAAGAGACACAAGAGATTCGGCCCTACTTC
AACGTCAAGGACGTCCGCCGCGCACCCAAGATTGAAGACGAAGACAGCCAAGGCCCGGCTGCGGGACTGGTGCCG
GGTCCGCCCAGCATCGCCGGGCCATCGAGTGCGGCGGCCAGCATTCGGCGCAGCAGGGCCAACAGCGCCAGCTCT
CGCTGCTCTGCGAGCAGTCTTGCCCGGGGCACTCGTCCCCATCGCAAGTCGTGGAGCTCCAAGGATTTCGCGCAG
TGGGACGCCGAGATGAGTCGGGGCGACGTGCAGCGCTCACGCAGCGGATCGCTTCGCTTGCATCCCATTGGTCAA
GATGCTCCGCGCACAATGGTTTCTGCGGCGAGGCGGCCGCCACTGCTGACGCCCATGAGAGAGTCGTTTGAGGGC
CCCATGTTGGCCATGTCGCCAGCATCGCCAGAGTCTCCTGATGGCAAGAATGTCTCTTTGGTCGTGGACAAGATT
GCCGAATCCACGGGCCCAGACAAGGCTGAAGGCGCATCCTCGCCTCAAGAGGGCACATGCCCACAGTCAACTGCA
AGCACGCCTGAGCCTGTTGACACTCAAGAGCCAGATGTGGCGTCTTTTAGCCATGGTTCCACGCCCGCAGCGCCC
TTGTCCATGGAGACAGACCAACCCACCACTAGCTCTGAGCCAGACCAAGGCTCTCTTGCAAATATAAATTCAACA
ACGCCCGAGAATAAGGCGTCTTGA
Gene >OphauB2|315
ATGCGTGGCGGCATGCTGCGACGACGGTCCTCGCCGCCCCTGGCCGCCATGGCTTTGCTTGCCTTGGTTCTGGCC
TGCCTCACATCATCGGCCCTGGCCCGGGACCAGGCTCGCATCAAGGGCTACGGCATTGATGGCAAGACGCGCGAG
CTCGACGTCAATCGCTACCCGGCCCTCTACACTGGCGACTTTGACGACTGCCTCGGCGGCGAGAGCCTCTTCAAC
GTAACCAAATTCGACGCCGCTTACTATGCCGACAACCTGACGGTCCTCTTCCACCTTGACGGTAGCACAAATATC
CGCAGCGAAAACTTGATTCGTGAGTCTGCCGCCAGCCTGCCTGCCCACCCCCGTCTGTTGCTCACGGCTATATCT
TGGCAGTCCACATCTCGGTCGAGGCATACGGCGAGAACCGCTTCAACATGACATACGATCCTTGCAAGGCAAACA
TTGGCAGCATGTGTCCTCTCAATGCCAGTGTGCCCGTTACTGCCTTTGCCGTGATACCCATCTCACCAACCGACG
TGGCTGGTATCCCGTCCATTGCCCTTGGCATCCCTGACCTGGAAGGCTTTGCCCGCCTCCAAATCTTTGCCAACT
CGACGCAAACAGAAATCGGCTGCTTTCAAGCCGTCATGACAAATGGCAACTCTTTTTCCCAGCCCCAGTATGTCG
GCACCATCATGGGCGTCTTCACCTTGTTGGCTGTCCTGGCCTCGTTTGCCACAGCAATATATGGCGTGAGCATAA
CGCATATGCGAACTCACTATGCCCATTCCTTTTCCCTTCTTGTCATTTTTGAGACTTTCCAATCCATCTTCTTCT
CGGGCGCTCTCACGGTCAACTGGCCCAGCGTGCTGCCAGCCTGGTGGAGCAACTTTGCTTGGTCTGCTGGCATGT
TTGCCAGCGATATCATGGTTCGCTCCATAAGCTCATTTGCTGGCGCCGATGCCAACATCAGCCAGGTTGGCGGAG
CAGGCTCTGTGCAAATTAATAATGGAGGGGGTCTATCGCAACAAATCTATGGCCGCTCGCTTGCCCCCTTGCTCT
TGGCAGAGAGGAGCAGTGCATCCGCCCTTGCGCCGCGCCAAAGTCACAATGCGAGCAATCCCTATGACTACACCT
GGAATGGTCGTCCGCGCACTCCGGGAATGCCCATGCCTGGCACTTGGCCAGGCTTTGCCGGCACTTTGTCTCTGG
TCAACGTGCCCCCAACCGAGGCCTTTATGATAGGCTTCATCTGGTTTCTCGTTGTCGTCGGCATCGTTGCTTCCT
TTGTTGTCAGCACCAAATTCCTCTTGGACTGGCTGATTCGACTCAAGCTCATCAAGACGGATGGATTCGATTTTT
TCCGTTCGCATCTGCCAGGCTACCTGGGCGCTGCACTACTTAGGACTCTCTTGATTGCCTTCTTCACCATGATGA
CGTTGGCCATGTATCAGTTTTCTCTGCATGGGCCCGCCGGGCCGACTGCCATTGCTGCCATGGTCTGGGTCGTGT
TTTTCGTTGGCATGGGAGGAACAGCTGCATATGCGTGTCGGTGTCGGCTGAGGGAAGGCAGCTTCGAAACCACTT
CTGACAAGATACGCGTGGAGCGTGGCACTCTGTTTAATAAGGTGCCCTTTGTTGTGGCGACGCGGGAAAGCAGCT
TGGGCCATGAAGAGAGGAGGGCCAAGCGCTTTCTCATCAGCTCTCTTCCCTTTTTCAGAATTCGGTATAGAGACC
GAGACCCGTATAGGACCAATGTCCACCAGGACCAGGGCTACGTGAAGCGCTTTGGGTGGCTTGCAGCTCGTTACC
GTCGCACCAGATGGTGGTTTTTTGCTGTATACGTCGGCTACCTTTTCATTAGGGCATGTTTTCTCGGCGGAGGCT
CGCGCACCCCTCTGGCCCAAGTTTTTGGCCTCTTCATCTTTGAGATATTGGCGTTGGTGGCAATCATCAAACTGA
GCCCCTTTGAGGGTAACCGTAACACGGCAATCGCTGTGTGGATATTGTCGATATCCAAAATCGTGACAACTGGAC
TTTCTATTGCATTTTTGCCAGACTTCAACTTGAGCCGCATTGTCGCCACAGTCCTCGGCATTATCATCATTGTTG
TGCAAGGATTCCTGGCGGTGGCAGTCTTGGTCCTTATTGCTGTGGGCATCGTTTCCTCATGGATGTCGCTTTCTC
GCAATCGACAAGAGTTTCCCGAGACACTTGACCAGACGCGAATTCAATACTTTGAGCACATGCAGGCCCGCGCGG
CGGATTTGCCCCGGCCGCCCAGAGTGCAAGTTGAAGAGACACAAGAGATTCGGCCCTACTTCAACGTCAAGGACG
TCCGCCGCGCACCCAAGATTGAAGACGAAGACAGCCAAGGCCCGGCTGCGGGACTGGTGCCGGGTCCGCCCAGCA
TCGCCGGGCCATCGAGTGCGGCGGCCAGCATTCGGCGCAGCAGGGCCAACAGCGCCAGCTCTCGCTGCTCTGCGA
GCAGTCTTGCCCGGGGCACTCGTCCCCATCGCAAGTCGTGGAGCTCCAAGGATTTCGCGCAGTGGGACGCCGAGA
TGAGTCGGGGCGACGTGCAGCGCTCACGCAGCGGATCGCTTCGCTTGCATCCCATTGGTCAAGATGCTCCGCGCA
CAATGGTTTCTGCGGCGAGGCGGCCGCCACTGCTGACGCCCATGAGAGAGTCGTTTGAGGGCCCCATGTTGGCCA
TGTCGCCAGCATCGCCAGAGTCTCCTGATGGCAAGAATGTCTCTTTGGTCGTGGACAAGATTGCCGAATCCACGG
GCCCAGACAAGGCTGAAGGCGCATCCTCGCCTCAAGAGGGCACATGCCCACAGTCAACTGCAAGCACGCCTGAGC
CTGTTGACACTCAAGAGCCAGATGTGGCGTCTTTTAGCCATGGTTCCACGCCCGCAGCGCCCTTGTCCATGGAGA
CAGACCAACCCACCACTAGCTCTGAGCCAGACCAAGGCTCTCTTGCAAATATAAATTCAACAACGCCCGAGAATA
AGGCGTCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail