Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|314
Gene name
LocationContig_101:65318..66997
Strand+
Gene length (bp)1679
Transcript length (bp)1554
Coding sequence length (bp)1554
Protein length (aa) 518

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01169 UPF0016 Uncharacterized protein family UPF0016 2.3E-20 254 327
PF01169 UPF0016 Uncharacterized protein family UPF0016 8.2E-20 434 507

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38301|GDT1_YEAST GCR1-dependent translation factor 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GDT1 PE=1 SV=1 249 517 2.0E-59
sp|Q10320|YD68_SCHPO GDT1-like protein C17G8.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17G8.08c PE=3 SV=1 226 515 2.0E-53
sp|Q9HC07|TM165_HUMAN Transmembrane protein 165 OS=Homo sapiens GN=TMEM165 PE=1 SV=1 249 508 2.0E-50
sp|Q4V899|TM165_RAT Transmembrane protein 165 OS=Rattus norvegicus GN=Tmem165 PE=2 SV=1 232 508 4.0E-49
sp|P52875|TM165_MOUSE Transmembrane protein 165 OS=Mus musculus GN=Tmem165 PE=1 SV=2 236 508 7.0E-49
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38301|GDT1_YEAST GCR1-dependent translation factor 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GDT1 PE=1 SV=1 249 517 2.0E-59
sp|Q10320|YD68_SCHPO GDT1-like protein C17G8.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17G8.08c PE=3 SV=1 226 515 2.0E-53
sp|Q9HC07|TM165_HUMAN Transmembrane protein 165 OS=Homo sapiens GN=TMEM165 PE=1 SV=1 249 508 2.0E-50
sp|Q4V899|TM165_RAT Transmembrane protein 165 OS=Rattus norvegicus GN=Tmem165 PE=2 SV=1 232 508 4.0E-49
sp|P52875|TM165_MOUSE Transmembrane protein 165 OS=Mus musculus GN=Tmem165 PE=1 SV=2 236 508 7.0E-49
sp|Q9P7Q0|YLY5_SCHPO GDT1-like protein C186.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC186.05c PE=3 SV=1 254 513 3.0E-37
sp|B9G125|GDT15_ORYSJ GDT1-like protein 5 OS=Oryza sativa subsp. japonica GN=Os08g0433100 PE=2 SV=1 249 512 1.0E-34
sp|Q9C6M1|GDT14_ARATH GDT1-like protein 4 OS=Arabidopsis thaliana GN=At1g25520 PE=2 SV=1 249 517 4.0E-33
sp|Q2R4J1|GDT13_ORYSJ GDT1-like protein 3 OS=Oryza sativa subsp. japonica GN=Os11g0472500 PE=2 SV=1 255 508 2.0E-32
sp|A2ZE50|GDT13_ORYSI GDT1-like protein 3 OS=Oryza sativa subsp. indica GN=OsI_36063 PE=3 SV=1 255 508 2.0E-32
sp|Q9SX28|GDT15_ARATH GDT1-like protein 5 OS=Arabidopsis thaliana GN=At1g68650 PE=1 SV=1 249 508 3.0E-32
sp|Q93Y38|GDT13_ARATH GDT1-like protein 3 OS=Arabidopsis thaliana GN=At5g36290 PE=2 SV=1 255 508 2.0E-31
sp|Q9T0H9|GDT12_ARATH GDT1-like protein 2, chloroplastic OS=Arabidopsis thaliana GN=At4g13590 PE=1 SV=2 173 511 2.0E-24
sp|Q2R2Z4|GDT12_ORYSJ GDT1-like protein 2, chloroplastic OS=Oryza sativa subsp. japonica GN=Os11g0544500 PE=2 SV=1 252 512 1.0E-23
sp|P52876|Y615_SYNY3 GDT1-like protein sll0615 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0615 PE=3 SV=1 433 509 6.0E-19
sp|A2YXC7|GDT14_ORYSI GDT1-like protein 4 OS=Oryza sativa subsp. indica GN=OsI_29993 PE=3 SV=1 251 331 2.0E-18
sp|Q6ZIB9|GDT14_ORYSJ GDT1-like protein 4 OS=Oryza sativa subsp. japonica GN=Os08g0528500 PE=2 SV=1 251 331 2.0E-18
sp|A2YXC7|GDT14_ORYSI GDT1-like protein 4 OS=Oryza sativa subsp. indica GN=OsI_29993 PE=3 SV=1 423 508 4.0E-15
sp|Q6ZIB9|GDT14_ORYSJ GDT1-like protein 4 OS=Oryza sativa subsp. japonica GN=Os08g0528500 PE=2 SV=1 423 508 4.0E-15
sp|P52876|Y615_SYNY3 GDT1-like protein sll0615 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0615 PE=3 SV=1 249 380 9.0E-14
sp|Q94AX5|GDT11_ARATH GDT1-like protein 1, chloroplastic OS=Arabidopsis thaliana GN=At1g64150 PE=2 SV=2 252 371 1.0E-10
sp|Q5NAY7|GDT11_ORYSJ GDT1-like protein 1, chloroplastic OS=Oryza sativa subsp. japonica GN=Os01g0221700 PE=3 SV=2 434 517 8.0E-10
sp|B8AAM2|GDT11_ORYSI GDT1-like protein 1, chloroplastic OS=Oryza sativa subsp. indica GN=OsI_00941 PE=3 SV=2 434 517 8.0E-10
sp|B8AAM2|GDT11_ORYSI GDT1-like protein 1, chloroplastic OS=Oryza sativa subsp. indica GN=OsI_00941 PE=3 SV=2 252 373 8.0E-09
sp|Q5NAY7|GDT11_ORYSJ GDT1-like protein 1, chloroplastic OS=Oryza sativa subsp. japonica GN=Os01g0221700 PE=3 SV=2 252 373 1.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 25 0.45

Transmembrane Domains

Domain # Start End Length
1 253 275 22
2 282 304 22
3 314 331 17
4 419 441 22
5 461 483 22
6 490 512 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|314
MWFNGLHSPLLLLLLPSLATSLAAAPRSTPRRQDDSISAYDDDAAVKPQKGLASKAPFDDGKPHTGPFVETDGKA
TDSNAQDLPPLKGRPRDPTIVDGKKIPESNDGVMFDKNRQRPLEGTTGTEGGVSQKALARKAREGQTGEKALTQP
ESPKERPPLPHSEEQKLGTVDAWGKVKSKQSSDKDEDNTDYTGLDKPANLPDTGREKTNPLPKSADKDHLETSQP
ILASTRTAKPPLEETDQDGIVQPLHSFVLSLAMILVSEVGDKTFLVAALMAMKHDRIVVFSAAYGALVVMTVLSA
VLGHAVPTLIPKKLTSLLAAVLFLVFGVKLLREGMQMSPDEGVSAEMQEVEQELAEKEKELGRRGRGPISAHSLE
MGFQSRKSRTKNRFPSPPRSPSQSPSPSLSPSRRTGSVDSLFQGVGNLCSLLLSPAWVQTFAMTFLGEWGDRSQI
ATIAMAAGQDYWWVTLGALCGHAVCTGVAVLGGRAIAGRVSLKVVTVGGAVAFLFFALLYFIESLRS*
Coding >OphauB2|314
ATGTGGTTCAACGGCCTACATTCACCCTTGCTGCTTCTTCTTCTTCCTTCGCTCGCTACCTCGTTGGCCGCCGCT
CCACGCTCAACTCCACGCAGACAGGACGACTCCATCTCGGCCTACGACGATGACGCAGCCGTAAAGCCCCAAAAG
GGCCTCGCAAGCAAGGCACCCTTTGACGACGGCAAGCCACATACCGGTCCCTTTGTGGAGACGGACGGAAAAGCC
ACCGATTCCAACGCTCAGGACTTGCCTCCTCTAAAAGGCCGACCGCGCGATCCCACTATTGTTGACGGCAAAAAG
ATACCCGAGTCCAACGACGGCGTCATGTTTGACAAGAACCGCCAGCGGCCTCTAGAGGGCACGACTGGCACCGAG
GGTGGTGTTTCGCAAAAAGCCCTGGCACGCAAAGCCAGGGAGGGCCAGACGGGCGAGAAGGCGCTCACACAACCA
GAATCGCCCAAAGAGCGTCCGCCTTTGCCTCACAGCGAAGAACAGAAACTGGGAACTGTGGATGCTTGGGGCAAG
GTCAAGTCGAAGCAGTCTTCTGACAAGGATGAGGACAATACCGACTATACTGGTCTCGATAAACCCGCCAATTTG
CCCGACACTGGACGCGAAAAGACGAATCCACTACCCAAGTCTGCTGATAAAGACCATCTCGAGACATCACAACCC
ATTCTGGCCTCGACACGCACCGCCAAGCCTCCTCTGGAAGAAACGGACCAAGATGGCATCGTTCAGCCCCTCCAC
TCCTTTGTCTTGTCCCTTGCCATGATCCTTGTCTCCGAAGTGGGCGACAAAACGTTTCTGGTGGCTGCCCTCATG
GCCATGAAACACGATCGCATCGTCGTCTTCTCAGCTGCCTATGGCGCCCTTGTCGTCATGACGGTTCTCTCAGCC
GTTCTCGGGCACGCTGTCCCGACGCTGATACCCAAGAAGCTGACCAGTCTTCTCGCTGCCGTCCTGTTTCTCGTT
TTTGGCGTCAAGCTTCTCCGAGAAGGCATGCAAATGAGCCCTGACGAGGGCGTCAGTGCCGAAATGCAGGAAGTA
GAGCAAGAGCTAGCTGAAAAAGAAAAGGAGCTTGGACGACGCGGACGTGGCCCCATCTCGGCGCATTCTCTCGAA
ATGGGGTTCCAGAGCAGAAAGTCACGCACCAAGAACCGCTTTCCTTCGCCCCCTCGCTCCCCGTCACAGTCGCCA
TCACCATCTTTGAGTCCTTCTCGTCGAACGGGATCAGTCGACAGCCTTTTCCAGGGTGTTGGCAACTTGTGCTCG
CTACTGCTGAGTCCTGCATGGGTGCAAACGTTTGCCATGACATTTTTGGGCGAATGGGGAGATCGTAGCCAGATT
GCCACCATTGCCATGGCTGCCGGACAAGACTACTGGTGGGTAACACTGGGGGCTTTGTGTGGGCATGCCGTCTGC
ACTGGTGTTGCTGTCCTCGGTGGTCGGGCTATAGCGGGGCGAGTCAGTCTCAAAGTTGTCACGGTTGGTGGCGCC
GTTGCCTTTCTCTTCTTCGCCTTGCTCTACTTTATCGAGTCTCTACGCTCATAG
Transcript >OphauB2|314
ATGTGGTTCAACGGCCTACATTCACCCTTGCTGCTTCTTCTTCTTCCTTCGCTCGCTACCTCGTTGGCCGCCGCT
CCACGCTCAACTCCACGCAGACAGGACGACTCCATCTCGGCCTACGACGATGACGCAGCCGTAAAGCCCCAAAAG
GGCCTCGCAAGCAAGGCACCCTTTGACGACGGCAAGCCACATACCGGTCCCTTTGTGGAGACGGACGGAAAAGCC
ACCGATTCCAACGCTCAGGACTTGCCTCCTCTAAAAGGCCGACCGCGCGATCCCACTATTGTTGACGGCAAAAAG
ATACCCGAGTCCAACGACGGCGTCATGTTTGACAAGAACCGCCAGCGGCCTCTAGAGGGCACGACTGGCACCGAG
GGTGGTGTTTCGCAAAAAGCCCTGGCACGCAAAGCCAGGGAGGGCCAGACGGGCGAGAAGGCGCTCACACAACCA
GAATCGCCCAAAGAGCGTCCGCCTTTGCCTCACAGCGAAGAACAGAAACTGGGAACTGTGGATGCTTGGGGCAAG
GTCAAGTCGAAGCAGTCTTCTGACAAGGATGAGGACAATACCGACTATACTGGTCTCGATAAACCCGCCAATTTG
CCCGACACTGGACGCGAAAAGACGAATCCACTACCCAAGTCTGCTGATAAAGACCATCTCGAGACATCACAACCC
ATTCTGGCCTCGACACGCACCGCCAAGCCTCCTCTGGAAGAAACGGACCAAGATGGCATCGTTCAGCCCCTCCAC
TCCTTTGTCTTGTCCCTTGCCATGATCCTTGTCTCCGAAGTGGGCGACAAAACGTTTCTGGTGGCTGCCCTCATG
GCCATGAAACACGATCGCATCGTCGTCTTCTCAGCTGCCTATGGCGCCCTTGTCGTCATGACGGTTCTCTCAGCC
GTTCTCGGGCACGCTGTCCCGACGCTGATACCCAAGAAGCTGACCAGTCTTCTCGCTGCCGTCCTGTTTCTCGTT
TTTGGCGTCAAGCTTCTCCGAGAAGGCATGCAAATGAGCCCTGACGAGGGCGTCAGTGCCGAAATGCAGGAAGTA
GAGCAAGAGCTAGCTGAAAAAGAAAAGGAGCTTGGACGACGCGGACGTGGCCCCATCTCGGCGCATTCTCTCGAA
ATGGGGTTCCAGAGCAGAAAGTCACGCACCAAGAACCGCTTTCCTTCGCCCCCTCGCTCCCCGTCACAGTCGCCA
TCACCATCTTTGAGTCCTTCTCGTCGAACGGGATCAGTCGACAGCCTTTTCCAGGGTGTTGGCAACTTGTGCTCG
CTACTGCTGAGTCCTGCATGGGTGCAAACGTTTGCCATGACATTTTTGGGCGAATGGGGAGATCGTAGCCAGATT
GCCACCATTGCCATGGCTGCCGGACAAGACTACTGGTGGGTAACACTGGGGGCTTTGTGTGGGCATGCCGTCTGC
ACTGGTGTTGCTGTCCTCGGTGGTCGGGCTATAGCGGGGCGAGTCAGTCTCAAAGTTGTCACGGTTGGTGGCGCC
GTTGCCTTTCTCTTCTTCGCCTTGCTCTACTTTATCGAGTCTCTACGCTCATAG
Gene >OphauB2|314
ATGTGGTTCAACGGCCTACATTCACCCTTGCTGCTTCTTCTTCTTCCTTCGCTCGCTACCTCGTTGGCCGCCGCT
CCACGCTCAACTCCACGCAGACAGGACGACTCCATCTCGGCCTACGACGATGACGCAGCCGTAAAGCCCCAAAAG
GGCCTCGCAAGCAAGGCACCCTTTGACGACGGCAAGCCACATACCGGTCCCTTTGTGGAGACGGACGGAAAAGCC
ACCGATTCCAACGCTCAGGACTTGCCTCCTCTAAAAGGCCGACCGCGCGATCCCACTATTGTTGACGGCAAAAAG
ATACCCGAGTCCAACGACGGCGTCATGTTTGACAAGAACCGCCAGCGGCCTCTAGAGGGCACGACTGGCACCGAG
GGTGGTGTTTCGCAAAAAGCCCTGGCACGCAAAGCCAGGGAGGGCCAGACGGGCGAGAAGGCGCTCACACAACCA
GAATCGCCCAAAGAGCGTCCGCCTTTGCCTCACAGCGAAGAACAGAAACTGGGAACTGTGGATGCTTGGGGCAAG
GTCAAGTCGAAGCAGTCTTCTGACAAGGATGAGGACAATACCGACTATACTGGTCTCGATGTTGGTCTCAATGCT
GCATCTTGTGTCTTACTTGCAGAAACCTTGCTGACATGGTGCCACGGGAGCAGAAACCCGCCAATTTGCCCGACA
CTGGACGCGAAAAGACGAATCCACTACCCAAGTCTGCTGATAAAGACCATCTCGAGACATCACAACCCATTCTGG
CCTCGACACGCACCGCCAAGCCTCCTCTGGAAGAAACGGACCAAGATGGCATCGTTCAGCCCCTCCACTCCTTTG
TCTTGTCCCTTGCCATGATCCTTGTCTCCGAAGTGGGCGACAAAACGTTTCTGGTGGCTGCCCTCATGGCCATGA
AACACGATCGCATCGTCGTCTTCTCAGCTGCCTATGGCGCCCTTGTCGTCATGACGGTTCTCTCAGCCGTTCTCG
GGCACGCTGTCCCGACGCTGATACCCAAGAAGCTGACCAGTCTTCTCGCTGCCGTCCTGTTTCTCGTTTTTGGCG
TCAAGCTTCTCCGAGAAGGCATGCAAATGAGCCCTGACGAGGGCGTCAGTGCCGAAATGCAGGAAGTAGAGCAAG
AGCTAGCTGAAAAAGAAAAGGAGCTTGGACGACGCGGACGTGGCCCCATCTCGGCGCATTCTCTCGAAATGGGGT
TCCAGAGCAGAAAGTCACGCACCAAGAACCGCTTTCCTTCGCCCCCTCGCTCCCCGTCACAGTCGCCATCACCAT
CTTTGAGTCCTTCTCGTCGAACGGGATCAGTCGACAGCCTTTTCCAGGGTGTTGGCAACTTGTGCTCGCTACTGC
TGAGTCCTGCATGGGTGCAAACGTTTGCCATGACATTTTTGGGCGAATGGGGAGATCGTAGCCAGATTGCCACCA
TTGCCATGGCTGCCGGACAAGACTACTGGTGGGTAACACTGGGGGCTTTGTGTGGGCATGCCGTCTGCACTGGTG
TTGCTGTCCTCGGTGGTCGGGCTATAGCGGGGCGAGTCAGTCTCAAAGTTGGTGAGTTTGGTGGCAAGCAATCAT
GTTTGCAGTAACATGACACTGACAAGCCAACAGTCACGGTTGGTGGCGCCGTTGCCTTTCTCTTCTTCGCCTTGC
TCTACTTTATCGAGTCTCTACGCTCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail