Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3137
Gene name
LocationContig_201:922..1432
Strand-
Gene length (bp)510
Transcript length (bp)510
Coding sequence length (bp)510
Protein length (aa) 170

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00083 Sugar_tr Sugar (and other) transporter 1.6E-16 52 157

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P25346|GIT1_YEAST Probable metabolite transport protein GIT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIT1 PE=1 SV=1 39 157 2.0E-21
sp|O94342|YHM9_SCHPO Probable metabolite transport protein C1271.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.09 PE=3 SV=1 40 158 4.0E-13
sp|Q8H6H0|PHT16_ORYSJ Inorganic phosphate transporter 1-6 OS=Oryza sativa subsp. japonica GN=PHT1-6 PE=1 SV=1 14 157 2.0E-09
sp|Q8GSD9|PHT12_ORYSJ Inorganic phosphate transporter 1-2 OS=Oryza sativa subsp. japonica GN=PTH1-2 PE=2 SV=1 42 157 7.0E-09
sp|Q8H6G9|PHT17_ORYSJ Probable inorganic phosphate transporter 1-7 OS=Oryza sativa subsp. japonica GN=PHT1-7 PE=2 SV=1 13 157 8.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P25346|GIT1_YEAST Probable metabolite transport protein GIT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIT1 PE=1 SV=1 39 157 2.0E-21
sp|O94342|YHM9_SCHPO Probable metabolite transport protein C1271.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.09 PE=3 SV=1 40 158 4.0E-13
sp|Q8H6H0|PHT16_ORYSJ Inorganic phosphate transporter 1-6 OS=Oryza sativa subsp. japonica GN=PHT1-6 PE=1 SV=1 14 157 2.0E-09
sp|Q8GSD9|PHT12_ORYSJ Inorganic phosphate transporter 1-2 OS=Oryza sativa subsp. japonica GN=PTH1-2 PE=2 SV=1 42 157 7.0E-09
sp|Q8H6G9|PHT17_ORYSJ Probable inorganic phosphate transporter 1-7 OS=Oryza sativa subsp. japonica GN=PHT1-7 PE=2 SV=1 13 157 8.0E-08
sp|Q494P0|PHT17_ARATH Probable inorganic phosphate transporter 1-7 OS=Arabidopsis thaliana GN=PHT1-7 PE=2 SV=2 13 157 9.0E-08
sp|Q96303|PHT14_ARATH Inorganic phosphate transporter 1-4 OS=Arabidopsis thaliana GN=PHT1-4 PE=1 SV=1 13 157 2.0E-07
sp|Q8H6G8|PHT18_ORYSJ Probable inorganic phosphate transporter 1-8 OS=Oryza sativa subsp. japonica GN=PHT1-8 PE=2 SV=1 9 157 3.0E-07
sp|Q8H074|PT112_ORYSJ Probable inorganic phosphate transporter 1-12 OS=Oryza sativa subsp. japonica GN=PHT1-12 PE=2 SV=1 42 157 5.0E-07
sp|O48639|PHT13_ARATH Probable inorganic phosphate transporter 1-3 OS=Arabidopsis thaliana GN=PHT1-3 PE=2 SV=1 13 157 6.0E-07
sp|Q8H6H4|PHT11_ORYSJ Inorganic phosphate transporter 1-1 OS=Oryza sativa subsp. japonica GN=PHT1-1 PE=2 SV=1 40 157 2.0E-06
sp|Q96243|PHT12_ARATH Probable inorganic phosphate transporter 1-2 OS=Arabidopsis thaliana GN=PHT1-2 PE=2 SV=2 13 157 2.0E-06
sp|Q9S735|PHT19_ARATH Probable inorganic phosphate transporter 1-9 OS=Arabidopsis thaliana GN=PHT1-9 PE=2 SV=1 42 157 2.0E-06
sp|Q8GYF4|PHT15_ARATH Probable inorganic phosphate transporter 1-5 OS=Arabidopsis thaliana GN=PHT1-5 PE=2 SV=2 42 157 3.0E-06
sp|Q8VYM2|PHT11_ARATH Inorganic phosphate transporter 1-1 OS=Arabidopsis thaliana GN=PHT1-1 PE=1 SV=2 13 157 3.0E-06
sp|Q7X7V2|PHT15_ORYSJ Probable inorganic phosphate transporter 1-5 OS=Oryza sativa subsp. japonica GN=PHT1-5 PE=2 SV=2 42 157 7.0E-06
sp|Q94DB8|PT111_ORYSJ Inorganic phosphate transporter 1-11 OS=Oryza sativa subsp. japonica GN=PHT1-11 PE=2 SV=1 42 157 8.0E-06
sp|Q8H6H2|PHT14_ORYSJ Probable inorganic phosphate transporter 1-4 OS=Oryza sativa subsp. japonica GN=PHT1-4 PE=2 SV=1 42 157 9.0E-06
sp|Q01MW8|PHT14_ORYSI Probable inorganic phosphate transporter 1-4 OS=Oryza sativa subsp. indica GN=PHT1-4 PE=2 SV=2 42 157 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0016021 integral component of membrane Yes
GO:0110165 cellular anatomical entity No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0008150 biological_process No
GO:0031224 intrinsic component of membrane No
GO:0051234 establishment of localization No
GO:0005575 cellular_component No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 49 0.5

Transmembrane Domains

Domain # Start End Length
1 31 50 19
2 79 101 22
3 108 130 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3137
MSRDSPLAAPKQAQDQVSVVSAPARHDVAKAAPSWATTVLMVLVGGLALFSDGYNAQVAAQMNPVFAQLYPHDFT
RSIRTALSNAFLVGQVFGMLFFGWAIDRLGRRRGIIGATAFLLVGIALACAAHGTSPTAMFWVMIVGRGVAGFGA
GGTCPCSNGRPSGRLLMPC*
Coding >OphauB2|3137
ATGAGCCGTGACTCCCCCTTGGCCGCGCCAAAGCAAGCCCAAGACCAAGTCAGCGTCGTTTCGGCGCCAGCTCGA
CATGACGTGGCCAAGGCGGCTCCATCGTGGGCTACCACGGTCCTCATGGTGCTGGTGGGCGGCCTGGCGCTCTTC
TCAGACGGCTACAACGCCCAGGTGGCGGCGCAGATGAATCCCGTCTTTGCGCAGCTCTATCCGCACGACTTTACT
CGGAGCATCCGTACCGCGCTCTCGAATGCCTTTCTGGTGGGCCAAGTCTTTGGCATGCTCTTTTTTGGCTGGGCC
ATTGACCGTCTGGGCCGCCGCCGCGGCATCATTGGCGCCACGGCCTTTCTCCTCGTCGGCATTGCCCTGGCTTGC
GCTGCCCATGGCACAAGTCCCACAGCCATGTTTTGGGTCATGATTGTTGGCCGTGGCGTCGCTGGCTTTGGCGCA
GGCGGTACTTGTCCATGCTCCAACGGCCGTCCGTCTGGCCGCTTGCTGATGCCCTGCTAG
Transcript >OphauB2|3137
ATGAGCCGTGACTCCCCCTTGGCCGCGCCAAAGCAAGCCCAAGACCAAGTCAGCGTCGTTTCGGCGCCAGCTCGA
CATGACGTGGCCAAGGCGGCTCCATCGTGGGCTACCACGGTCCTCATGGTGCTGGTGGGCGGCCTGGCGCTCTTC
TCAGACGGCTACAACGCCCAGGTGGCGGCGCAGATGAATCCCGTCTTTGCGCAGCTCTATCCGCACGACTTTACT
CGGAGCATCCGTACCGCGCTCTCGAATGCCTTTCTGGTGGGCCAAGTCTTTGGCATGCTCTTTTTTGGCTGGGCC
ATTGACCGTCTGGGCCGCCGCCGCGGCATCATTGGCGCCACGGCCTTTCTCCTCGTCGGCATTGCCCTGGCTTGC
GCTGCCCATGGCACAAGTCCCACAGCCATGTTTTGGGTCATGATTGTTGGCCGTGGCGTCGCTGGCTTTGGCGCA
GGCGGTACTTGTCCATGCTCCAACGGCCGTCCGTCTGGCCGCTTGCTGATGCCCTGCTAG
Gene >OphauB2|3137
ATGAGCCGTGACTCCCCCTTGGCCGCGCCAAAGCAAGCCCAAGACCAAGTCAGCGTCGTTTCGGCGCCAGCTCGA
CATGACGTGGCCAAGGCGGCTCCATCGTGGGCTACCACGGTCCTCATGGTGCTGGTGGGCGGCCTGGCGCTCTTC
TCAGACGGCTACAACGCCCAGGTGGCGGCGCAGATGAATCCCGTCTTTGCGCAGCTCTATCCGCACGACTTTACT
CGGAGCATCCGTACCGCGCTCTCGAATGCCTTTCTGGTGGGCCAAGTCTTTGGCATGCTCTTTTTTGGCTGGGCC
ATTGACCGTCTGGGCCGCCGCCGCGGCATCATTGGCGCCACGGCCTTTCTCCTCGTCGGCATTGCCCTGGCTTGC
GCTGCCCATGGCACAAGTCCCACAGCCATGTTTTGGGTCATGATTGTTGGCCGTGGCGTCGCTGGCTTTGGCGCA
GGCGGTACTTGTCCATGCTCCAACGGCCGTCCGTCTGGCCGCTTGCTGATGCCCTGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail