Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3114
Gene name
LocationContig_20:171941..173884
Strand+
Gene length (bp)1943
Transcript length (bp)1695
Coding sequence length (bp)1695
Protein length (aa) 565

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00561 Abhydrolase_1 alpha/beta hydrolase fold 9.6E-24 135 427
PF04083 Abhydro_lipase Partial alpha/beta-hydrolase lipase region 6.4E-21 81 148

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74430|TGCE1_SCHPO Probable lipase C1672.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1672.09 PE=1 SV=1 1 458 4.0E-137
sp|P78898|TGCE2_SCHPO Probable lipase C16A3.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16A3.12c PE=3 SV=2 7 451 2.0E-135
sp|O60095|TGCE3_SCHPO Probable lipase C14C8.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC14C8.15 PE=3 SV=1 17 444 3.0E-121
sp|P34163|TGL1_YEAST Sterol esterase TGL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TGL1 PE=1 SV=1 1 447 4.0E-117
sp|Q9Z0M5|LICH_MOUSE Lysosomal acid lipase/cholesteryl ester hydrolase OS=Mus musculus GN=Lipa PE=1 SV=2 80 446 1.0E-52
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74430|TGCE1_SCHPO Probable lipase C1672.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1672.09 PE=1 SV=1 1 458 4.0E-137
sp|P78898|TGCE2_SCHPO Probable lipase C16A3.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16A3.12c PE=3 SV=2 7 451 2.0E-135
sp|O60095|TGCE3_SCHPO Probable lipase C14C8.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC14C8.15 PE=3 SV=1 17 444 3.0E-121
sp|P34163|TGL1_YEAST Sterol esterase TGL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TGL1 PE=1 SV=1 1 447 4.0E-117
sp|Q9Z0M5|LICH_MOUSE Lysosomal acid lipase/cholesteryl ester hydrolase OS=Mus musculus GN=Lipa PE=1 SV=2 80 446 1.0E-52
sp|P80035|LIPG_CANLF Gastric triacylglycerol lipase OS=Canis lupus familiaris GN=LIPF PE=1 SV=2 83 445 2.0E-52
sp|P07098|LIPG_HUMAN Gastric triacylglycerol lipase OS=Homo sapiens GN=LIPF PE=1 SV=1 83 439 7.0E-50
sp|Q64194|LICH_RAT Lysosomal acid lipase/cholesteryl ester hydrolase OS=Rattus norvegicus GN=Lipa PE=2 SV=1 80 446 3.0E-47
sp|Q9CPP7|LIPG_MOUSE Gastric triacylglycerol lipase OS=Mus musculus GN=Lipf PE=2 SV=1 83 439 6.0E-47
sp|P04634|LIPG_RAT Gastric triacylglycerol lipase OS=Rattus norvegicus GN=Lipf PE=1 SV=1 83 443 6.0E-47
sp|Q5VXJ0|LIPK_HUMAN Lipase member K OS=Homo sapiens GN=LIPK PE=2 SV=2 83 446 1.0E-46
sp|J3SDX8|LICH_CROAD Putative lysosomal acid lipase/cholesteryl ester hydrolase OS=Crotalus adamanteus PE=2 SV=1 65 443 4.0E-46
sp|Q8BM14|LIPK_MOUSE Lipase member K OS=Mus musculus GN=Lipk PE=2 SV=1 80 436 7.0E-46
sp|Q4R4S5|LICH_MACFA Lysosomal acid lipase/cholesteryl ester hydrolase OS=Macaca fascicularis GN=LIPA PE=2 SV=1 83 446 2.0E-45
sp|P38571|LICH_HUMAN Lysosomal acid lipase/cholesteryl ester hydrolase OS=Homo sapiens GN=LIPA PE=1 SV=2 83 446 3.0E-45
sp|Q5W064|LIPJ_HUMAN Lipase member J OS=Homo sapiens GN=LIPJ PE=2 SV=3 83 443 7.0E-42
sp|Q29458|LIPG_BOVIN Gastric triacylglycerol lipase OS=Bos taurus GN=LIPF PE=1 SV=1 62 439 1.0E-41
sp|Q8K2A6|LIPM_MOUSE Lipase member M OS=Mus musculus GN=Lipm PE=2 SV=1 83 440 3.0E-40
sp|Q5VYY2|LIPM_HUMAN Lipase member M OS=Homo sapiens GN=LIPM PE=2 SV=2 80 468 3.0E-39
sp|Q3U4B4|LIPN_MOUSE Lipase member N OS=Mus musculus GN=Lipn PE=2 SV=1 83 446 6.0E-35
sp|Q3YBN2|TALLP_MESAU Tear acid lipase-like protein OS=Mesocricetus auratus PE=1 SV=1 83 430 6.0E-35
sp|O46108|LIP3_DROME Lipase 3 OS=Drosophila melanogaster GN=Lip3 PE=2 SV=1 89 446 2.0E-31
sp|O46107|LIP1_DROME Lipase 1 OS=Drosophila melanogaster GN=Lip1 PE=2 SV=2 58 460 2.0E-31
sp|Q5VXI9|LIPN_HUMAN Lipase member N OS=Homo sapiens GN=LIPN PE=2 SV=2 83 447 2.0E-30
sp|Q71DJ5|LIP1_ARATH Triacylglycerol lipase 1 OS=Arabidopsis thaliana GN=LIP1 PE=1 SV=1 90 439 2.0E-29
sp|Q07950|YEH2_YEAST Sterol esterase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YEH2 PE=1 SV=1 64 431 3.0E-24
sp|Q67ZU1|LIP2_ARATH Triacylglycerol lipase 2 OS=Arabidopsis thaliana GN=LIP2 PE=2 SV=1 49 431 1.0E-23
sp|Q07804|YEH1_YEAST Sterol esterase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YEH1 PE=1 SV=1 88 446 6.0E-13
[Show less]

GO

GO Term Description Terminal node
GO:0006629 lipid metabolic process Yes
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 13 35 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3672
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4736
Ophiocordyceps australis map64 (Brazil) OphauB2|3114 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|00841
Ophiocordyceps camponoti-rufipedis Ophun1|5514
Ophiocordyceps kimflemingae Ophio5|4707
Ophiocordyceps subramaniannii Hirsu2|7099

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3114
MAVPFLGRLHAAEYLALFASFLIVSLEAILRVLTLALPPLFVSFFYRASRRLFNRLSSPEQKKAENKKKSVSTAV
RDAPDFVELCRFWGYEAEEHIVQTKDGFLLGIHRLQWRKGEEGIHINAGPTGLKKRVAYLHHGLLMNSEVWVCLT
DEQRCLPFELLARGFDVWFGNNRGNKYSKKSINCSPSSARFWDFSMDEFAFYDIPDTIAYILDTTQQQSLSYIGF
SQGTAQAFATLAIHPRLNNQVNVFIGLAPAMAPAGLSNGIVDSLVKASPSVLYLMFGRRSILSSATMWETLLYPP
IFTGVIDMGLHFLFKWRTRNISASQKLAAYPHLYSFTSTKSVVHWFQIIRNKCFQMYDDDVPQPVALASAFKYSK
VAKYPTRNIRTPVVLVYGGSDSLVDIHSMLKELPPQTVATEIPHYEHLDFLWARDVDSQLFQHVFDALDSFTDAQ
HSQEEYDRYRVARCESLIGSAYVHRGSESDASTVAAPAPDDVPSPTTLRHRAREEAFGALGTGAVATALPNMLRS
GDTLKGVGVRRGASATNAISSTTADVAKNPEPSPTSQPE*
Coding >OphauB2|3114
ATGGCCGTTCCCTTTCTCGGGCGGCTGCACGCAGCCGAGTATCTTGCCCTGTTTGCATCCTTTCTCATTGTCAGT
CTTGAAGCCATACTGCGCGTCTTGACTCTTGCTCTGCCGCCCTTGTTCGTCTCCTTTTTTTACCGCGCCTCGCGC
CGCCTCTTTAACCGCCTCTCGTCGCCCGAGCAGAAAAAGGCGGAAAACAAGAAAAAGTCCGTCTCCACCGCAGTC
CGCGATGCCCCCGACTTTGTCGAGCTCTGCCGCTTCTGGGGCTACGAGGCAGAGGAGCACATTGTCCAGACCAAG
GATGGCTTCCTCCTTGGAATCCACCGCTTGCAGTGGCGCAAGGGCGAGGAGGGCATCCACATCAATGCCGGCCCC
ACGGGCCTCAAGAAGCGCGTCGCCTATCTCCACCACGGCCTGCTCATGAACTCCGAGGTCTGGGTCTGCTTGACC
GACGAGCAGCGCTGCCTCCCCTTTGAGCTGCTTGCCAGAGGCTTTGATGTCTGGTTTGGCAACAACCGTGGCAAC
AAGTACTCCAAAAAGTCCATCAATTGCTCGCCCTCGTCGGCCCGCTTCTGGGACTTTTCCATGGACGAGTTTGCC
TTTTACGACATCCCCGACACCATTGCCTATATCCTCGACACAACGCAGCAGCAGAGCCTGTCCTACATTGGCTTC
TCCCAGGGCACCGCCCAGGCCTTTGCCACTCTGGCCATCCACCCGCGCCTCAACAACCAGGTCAATGTCTTTATT
GGCCTCGCCCCGGCCATGGCCCCCGCCGGCCTGTCCAACGGCATCGTCGACTCCCTCGTCAAGGCGTCGCCCTCG
GTCCTCTATCTCATGTTTGGCCGCCGCTCCATCCTCAGCTCAGCCACCATGTGGGAAACGCTGCTCTACCCGCCC
ATCTTCACCGGCGTCATCGACATGGGCCTTCACTTTCTCTTCAAGTGGCGCACCCGCAACATCTCGGCCAGCCAG
AAACTGGCCGCCTATCCCCATCTCTACTCCTTTACCAGCACAAAGAGCGTTGTGCACTGGTTCCAAATCATTCGC
AACAAGTGCTTCCAAATGTACGACGACGACGTGCCCCAGCCCGTCGCCCTCGCCTCCGCCTTCAAGTACTCCAAG
GTGGCCAAGTATCCTACCCGCAACATCCGCACCCCAGTTGTCCTTGTCTACGGCGGCTCCGACTCCCTCGTCGAC
ATCCACTCCATGCTCAAGGAGCTGCCTCCACAAACCGTTGCCACCGAGATTCCTCACTACGAACACCTCGACTTT
CTCTGGGCCCGCGATGTCGACTCGCAGCTCTTCCAGCACGTTTTCGACGCCCTCGACTCCTTTACCGACGCACAG
CACTCCCAGGAAGAGTACGACCGATACCGCGTTGCCCGTTGCGAGAGCCTGATTGGCTCAGCCTATGTCCACCGC
GGCAGCGAGAGCGATGCCTCGACGGTTGCTGCGCCGGCCCCCGACGACGTGCCCTCTCCTACCACACTGCGCCAT
CGCGCCCGCGAAGAGGCCTTTGGTGCTCTCGGCACCGGCGCTGTCGCCACGGCTCTTCCCAATATGCTCCGTTCT
GGCGACACGCTCAAGGGCGTGGGCGTTCGAAGAGGGGCCTCTGCCACCAATGCTATTTCGAGCACCACGGCCGAC
GTTGCCAAAAACCCCGAGCCATCACCCACAAGTCAGCCCGAGTAA
Transcript >OphauB2|3114
ATGGCCGTTCCCTTTCTCGGGCGGCTGCACGCAGCCGAGTATCTTGCCCTGTTTGCATCCTTTCTCATTGTCAGT
CTTGAAGCCATACTGCGCGTCTTGACTCTTGCTCTGCCGCCCTTGTTCGTCTCCTTTTTTTACCGCGCCTCGCGC
CGCCTCTTTAACCGCCTCTCGTCGCCCGAGCAGAAAAAGGCGGAAAACAAGAAAAAGTCCGTCTCCACCGCAGTC
CGCGATGCCCCCGACTTTGTCGAGCTCTGCCGCTTCTGGGGCTACGAGGCAGAGGAGCACATTGTCCAGACCAAG
GATGGCTTCCTCCTTGGAATCCACCGCTTGCAGTGGCGCAAGGGCGAGGAGGGCATCCACATCAATGCCGGCCCC
ACGGGCCTCAAGAAGCGCGTCGCCTATCTCCACCACGGCCTGCTCATGAACTCCGAGGTCTGGGTCTGCTTGACC
GACGAGCAGCGCTGCCTCCCCTTTGAGCTGCTTGCCAGAGGCTTTGATGTCTGGTTTGGCAACAACCGTGGCAAC
AAGTACTCCAAAAAGTCCATCAATTGCTCGCCCTCGTCGGCCCGCTTCTGGGACTTTTCCATGGACGAGTTTGCC
TTTTACGACATCCCCGACACCATTGCCTATATCCTCGACACAACGCAGCAGCAGAGCCTGTCCTACATTGGCTTC
TCCCAGGGCACCGCCCAGGCCTTTGCCACTCTGGCCATCCACCCGCGCCTCAACAACCAGGTCAATGTCTTTATT
GGCCTCGCCCCGGCCATGGCCCCCGCCGGCCTGTCCAACGGCATCGTCGACTCCCTCGTCAAGGCGTCGCCCTCG
GTCCTCTATCTCATGTTTGGCCGCCGCTCCATCCTCAGCTCAGCCACCATGTGGGAAACGCTGCTCTACCCGCCC
ATCTTCACCGGCGTCATCGACATGGGCCTTCACTTTCTCTTCAAGTGGCGCACCCGCAACATCTCGGCCAGCCAG
AAACTGGCCGCCTATCCCCATCTCTACTCCTTTACCAGCACAAAGAGCGTTGTGCACTGGTTCCAAATCATTCGC
AACAAGTGCTTCCAAATGTACGACGACGACGTGCCCCAGCCCGTCGCCCTCGCCTCCGCCTTCAAGTACTCCAAG
GTGGCCAAGTATCCTACCCGCAACATCCGCACCCCAGTTGTCCTTGTCTACGGCGGCTCCGACTCCCTCGTCGAC
ATCCACTCCATGCTCAAGGAGCTGCCTCCACAAACCGTTGCCACCGAGATTCCTCACTACGAACACCTCGACTTT
CTCTGGGCCCGCGATGTCGACTCGCAGCTCTTCCAGCACGTTTTCGACGCCCTCGACTCCTTTACCGACGCACAG
CACTCCCAGGAAGAGTACGACCGATACCGCGTTGCCCGTTGCGAGAGCCTGATTGGCTCAGCCTATGTCCACCGC
GGCAGCGAGAGCGATGCCTCGACGGTTGCTGCGCCGGCCCCCGACGACGTGCCCTCTCCTACCACACTGCGCCAT
CGCGCCCGCGAAGAGGCCTTTGGTGCTCTCGGCACCGGCGCTGTCGCCACGGCTCTTCCCAATATGCTCCGTTCT
GGCGACACGCTCAAGGGCGTGGGCGTTCGAAGAGGGGCCTCTGCCACCAATGCTATTTCGAGCACCACGGCCGAC
GTTGCCAAAAACCCCGAGCCATCACCCACAAGTCAGCCCGAGTAA
Gene >OphauB2|3114
ATGGCCGTTCCCTTTCTCGGGCGGCTGCACGCGTGAGTGCGGCGGCTCGACTGCGCGCCCTTGCTTTAAGCTAAC
GCCCTCCCTCGACAGAGCCGAGTATCTTGCCCTGTTTGCATCCTTTCTCATTGTCAGTCTTGAAGCCATACTGCG
CGTCTTGACTCTTGCTCTGCGTAAGCCTGGTGCCCTGCCATGCCTGGCAGTGTCTGCCTGCCCTGCTAACAATGC
TCCAAGCGCCCTTGTTCGTCTCCTTTTTTTACCGCGCCTCGCGCCGCCTCTTTAACCGCCTCTCGTCGCCCGAGC
AGAAAAAGGCGGAAAACAAGAAAAAGTGTCTGTCCTGCACCAACCCAAGGACCAGAATCAAGGCCTGCAAACGCC
ATTGCTGACCCTTTTTTTGCACCTCTAGCCGTCTCCACCGCAGTCCGCGATGCCCCCGACTTTGTCGAGCTCTGC
CGCTTCTGGGGCTACGAGGCAGAGGAGCACATTGTCCAGACCAAGGATGGCTTCCTCCTTGGAATCCACCGCTTG
CAGTGGCGCAAGGGCGAGGAGGGCATCCACATCAATGCCGGCCCCACGGGCCTCAAGAAGCGCGTCGCCTATCTC
CACCACGGCCTGCTCATGAACTCCGAGGTCTGGGTCTGCTTGACCGACGAGCAGCGCTGCCTCCCCTTTGAGCTG
CTTGCCAGAGGCTTTGATGTCTGGGTAAGCAGGACGCACCCGCTTGTTGGCTGCTTGTCGCCACTGACATGCTCC
AGTTTGGCAACAACCGTGGCAACAAGTACTCCAAAAAGTCCATCAATTGCTCGCCCTCGTCGGCCCGCTTCTGGG
ACTTTTCCATGGACGAGTTTGCCTTTTACGACATCCCCGACACCATTGCCTATATCCTCGACACAACGCAGCAGC
AGAGCCTGTCCTACATTGGCTTCTCCCAGGGCACCGCCCAGGCCTTTGCCACTCTGGCCATCCACCCGCGCCTCA
ACAACCAGGTCAATGTCTTTATTGGCCTCGCCCCGGCCATGGCCCCCGCCGGCCTGTCCAACGGCATCGTCGACT
CCCTCGTCAAGGCGTCGCCCTCGGTCCTCTATCTCATGTTTGGCCGCCGCTCCATCCTCAGCTCAGCCACCATGT
GGGAAACGCTGCTCTACCCGCCCATCTTCACCGGCGTCATCGACATGGGCCTTCACTTTCTCTTCAAGTGGCGCA
CCCGCAACATCTCGGCCAGCCAGAAACTGGCCGCCTATCCCCATCTCTACTCCTTTACCAGCACAAAGAGCGTTG
TGCACTGGTTCCAAATCATTCGCAACAAGTGCTTCCAAATGTACGACGACGACGTGCCCCAGCCCGTCGCCCTCG
CCTCCGCCTTCAAGTACTCCAAGGTGGCCAAGTATCCTACCCGCAACATCCGCACCCCAGTTGTCCTTGTCTACG
GCGGCTCCGACTCCCTCGTCGACATCCACTCCATGCTCAAGGAGCTGCCTCCACAAACCGTTGCCACCGAGATTC
CTCACTACGAACACCTCGACTTTCTCTGGGCCCGCGATGTCGACTCGCAGCTCTTCCAGCACGTTTTCGACGCCC
TCGACTCCTTTACCGACGCACAGCACTCCCAGGAAGAGTACGACCGATACCGCGTTGCCCGTTGCGAGAGCCTGA
TTGGCTCAGCCTATGTCCACCGCGGCAGCGAGAGCGATGCCTCGACGGTTGCTGCGCCGGCCCCCGACGACGTGC
CCTCTCCTACCACACTGCGCCATCGCGCCCGCGAAGAGGCCTTTGGTGCTCTCGGCACCGGCGCTGTCGCCACGG
CTCTTCCCAATATGCTCCGTTCTGGCGACACGCTCAAGGGCGTGGGCGTTCGAAGAGGGGCCTCTGCCACCAATG
CTATTTCGAGCACCACGGCCGACGTTGCCAAAAACCCCGAGCCATCACCCACAAGTCAGCCCGAGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail