Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|311
Gene name
LocationContig_101:58817..60171
Strand+
Gene length (bp)1354
Transcript length (bp)1068
Coding sequence length (bp)1068
Protein length (aa) 356

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00775 Dioxygenase_C Dioxygenase 3.7E-09 132 229

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0008199 ferric iron binding Yes
GO:0006725 cellular aromatic compound metabolic process Yes
GO:0046872 metal ion binding No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0044237 cellular metabolic process No
GO:0005506 iron ion binding No
GO:0043167 ion binding No
GO:0046914 transition metal ion binding No
GO:0043169 cation binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|311
MAKFAAVAALLALSAGVLAHPDKPHEIRAHLETRSRVASYAKRAVEKCSASAEAAAVRERAVARRSNKLEALRQK
RGIQAPTGDLERRADKAAFEKYNGISHDRTPGGFNRDTPAKDLFADNATSALMPETIIGPYYVEGELQRTDLTDG
QAGVPTHLDFQFIDINTCKPMPNLLIDIWSANSTGVYSGVAAPLQGGVNTTHGRGVQTSDADGVVQFDSIFPGHY
VGRTNHFHVMSTDGANVMPNGTFEGGNVRHIGQVYFDPSLISAVEALEPYKSNEQAVTSNTEDEFTADVASEDFD
PFMNYAYLGENPQDGVLMWLTIGLDPVADYNKNRTPASHWYSDGGVDLTNGTPLP*
Coding >OphauB2|311
ATGGCAAAGTTTGCTGCTGTTGCGGCCCTCCTGGCCCTGTCTGCTGGCGTTCTCGCCCACCCTGACAAGCCACAT
GAGATCCGAGCTCATCTCGAGACGCGGAGCCGCGTAGCATCTTATGCCAAGCGCGCTGTTGAAAAGTGCTCGGCT
TCCGCTGAAGCTGCTGCTGTGCGTGAGCGTGCCGTTGCTCGCCGCTCCAATAAGCTCGAGGCTCTTCGCCAGAAG
CGTGGCATCCAGGCTCCTACCGGTGACCTTGAGCGCCGTGCCGACAAGGCCGCCTTTGAAAAATACAACGGCATC
TCTCATGACCGGACCCCTGGAGGCTTCAACCGCGACACACCCGCCAAGGACCTCTTTGCCGACAATGCCACGAGT
GCTCTCATGCCCGAGACCATCATTGGCCCCTACTATGTCGAGGGCGAGCTGCAGCGCACCGACTTGACTGACGGC
CAGGCTGGCGTGCCAACCCACCTCGACTTCCAGTTCATCGACATCAACACGTGCAAGCCAATGCCCAACCTGCTC
ATCGACATCTGGTCCGCCAACTCGACCGGTGTCTACTCTGGAGTTGCTGCTCCTCTTCAGGGCGGCGTCAACACA
ACGCACGGCCGTGGTGTCCAGACGTCTGATGCCGATGGTGTTGTTCAGTTTGATAGCATCTTCCCCGGCCACTAT
GTCGGCCGTACCAACCACTTCCACGTCATGTCGACCGACGGCGCCAACGTGATGCCCAACGGCACCTTTGAGGGT
GGTAATGTCCGCCACATTGGCCAAGTCTACTTTGACCCGAGCCTGATTTCCGCTGTCGAGGCTCTTGAGCCCTAC
AAGTCCAACGAGCAAGCCGTCACCTCCAACACCGAGGACGAATTCACTGCCGATGTCGCGTCCGAGGACTTTGAT
CCCTTCATGAACTACGCCTACCTGGGCGAGAACCCTCAGGATGGTGTTCTCATGTGGCTCACCATTGGCCTTGAC
CCCGTGGCTGATTACAACAAGAACCGCACTCCCGCCTCACACTGGTACTCTGACGGCGGCGTGGATCTGACCAAC
GGCACTCCTCTTCCTTGA
Transcript >OphauB2|311
ATGGCAAAGTTTGCTGCTGTTGCGGCCCTCCTGGCCCTGTCTGCTGGCGTTCTCGCCCACCCTGACAAGCCACAT
GAGATCCGAGCTCATCTCGAGACGCGGAGCCGCGTAGCATCTTATGCCAAGCGCGCTGTTGAAAAGTGCTCGGCT
TCCGCTGAAGCTGCTGCTGTGCGTGAGCGTGCCGTTGCTCGCCGCTCCAATAAGCTCGAGGCTCTTCGCCAGAAG
CGTGGCATCCAGGCTCCTACCGGTGACCTTGAGCGCCGTGCCGACAAGGCCGCCTTTGAAAAATACAACGGCATC
TCTCATGACCGGACCCCTGGAGGCTTCAACCGCGACACACCCGCCAAGGACCTCTTTGCCGACAATGCCACGAGT
GCTCTCATGCCCGAGACCATCATTGGCCCCTACTATGTCGAGGGCGAGCTGCAGCGCACCGACTTGACTGACGGC
CAGGCTGGCGTGCCAACCCACCTCGACTTCCAGTTCATCGACATCAACACGTGCAAGCCAATGCCCAACCTGCTC
ATCGACATCTGGTCCGCCAACTCGACCGGTGTCTACTCTGGAGTTGCTGCTCCTCTTCAGGGCGGCGTCAACACA
ACGCACGGCCGTGGTGTCCAGACGTCTGATGCCGATGGTGTTGTTCAGTTTGATAGCATCTTCCCCGGCCACTAT
GTCGGCCGTACCAACCACTTCCACGTCATGTCGACCGACGGCGCCAACGTGATGCCCAACGGCACCTTTGAGGGT
GGTAATGTCCGCCACATTGGCCAAGTCTACTTTGACCCGAGCCTGATTTCCGCTGTCGAGGCTCTTGAGCCCTAC
AAGTCCAACGAGCAAGCCGTCACCTCCAACACCGAGGACGAATTCACTGCCGATGTCGCGTCCGAGGACTTTGAT
CCCTTCATGAACTACGCCTACCTGGGCGAGAACCCTCAGGATGGTGTTCTCATGTGGCTCACCATTGGCCTTGAC
CCCGTGGCTGATTACAACAAGAACCGCACTCCCGCCTCACACTGGTACTCTGACGGCGGCGTGGATCTGACCAAC
GGCACTCCTCTTCCTTGA
Gene >OphauB2|311
ATGGCAAAGTTTGCTGCTGTTGCGGCCCTCCTGGCCCTGTCTGCTGGCGTTCTCGCCCACCCTGACAAGCCACAT
GAGATCCGAGCTCATCTCGAGACGCGGAGCCGCGTAGCATCTTATGCCAAGCGCGCTGTTGAAAAGTGCTCGGCT
TCCGCTGAAGCTGCTGCTGTGCGTGAGCGTGCCGTTGCTCGCCGCTCCAATAAGCTCGAGGCTCTTCGCCAGAAG
CGTGGCATCCAGGCTCGTAAGTTTTTTTCTTCTCTCCTTCTTTCTTCTCCTTCTTTCTCCTCCCTTCTTTCTCTT
CCTCTGCCCCCTTTTCCTTGTCTCTCTTGTTCTTCCTCTTCTTTAGCCTCTTTTGCCGAACAAAGGACAAGAAGG
CTATAGACACACACATACACATACACACGTACACACATACACATACACACCCACATACACACACACAAATACACA
CATACACACACATATATATATATATATATATGTCCCCCTTTTTGATCAAAATATTCATGCCAACTCGCATCTTCC
AGCTACCGGTGACCTTGAGCGCCGTGCCGACAAGGCCGCCTTTGAAAAATACAACGGCATCTCTCATGACCGGAC
CCCTGGAGGCTTCAACCGCGACACACCCGCCAAGGACCTCTTTGCCGACAATGCCACGAGTGCTCTCATGCCCGA
GACCATCATTGGCCCCTACTATGTCGAGGGCGAGCTGCAGCGCACCGACTTGACTGACGGCCAGGCTGGCGTGCC
AACCCACCTCGACTTCCAGTTCATCGACATCAACACGTGCAAGCCAATGCCCAACCTGCTCATCGACATCTGGTC
CGCCAACTCGACCGGTGTCTACTCTGGAGTTGCTGCTCCTCTTCAGGGCGGCGTCAACACAACGCACGGCCGTGG
TGTCCAGACGTCTGATGCCGATGGTGTTGTTCAGTTTGATAGCATCTTCCCCGGCCACTATGTCGGCCGTACCAA
CCACTTCCACGTCATGTCGACCGACGGCGCCAACGTGATGCCCAACGGCACCTTTGAGGGTGGTAATGTCCGCCA
CATTGGCCAAGTCTACTTTGACCCGAGCCTGATTTCCGCTGTCGAGGCTCTTGAGCCCTACAAGTCCAACGAGCA
AGCCGTCACCTCCAACACCGAGGACGAATTCACTGCCGATGTCGCGTCCGAGGACTTTGATCCCTTCATGAACTA
CGCCTACCTGGGCGAGAACCCTCAGGATGGTGTTCTCATGTGGCTCACCATTGGCCTTGACCCCGTGGCTGATTA
CAACAAGAACCGCACTCCCGCCTCACACTGGTACTCTGACGGCGGCGTGGATCTGACCAACGGCACTCCTCTTCC
TTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail