Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3105
Gene name
LocationContig_20:147912..153065
Strand-
Gene length (bp)5153
Transcript length (bp)5025
Coding sequence length (bp)5025
Protein length (aa) 1675

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00780 CNH CNH domain 7.1E-57 1331 1617
PF00621 RhoGEF RhoGEF domain 9.6E-32 865 1051
PF15405 PH_5 Pleckstrin homology domain 1.2E-11 1089 1244

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7U5|RGF3_SCHPO Rho1 guanine nucleotide exchange factor 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rgf3 PE=1 SV=1 706 1666 4.0E-103
sp|Q9Y7U6|RGF1_SCHPO Rho1 guanine nucleotide exchange factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rgf1 PE=1 SV=1 798 1625 1.0E-49
sp|Q9UTR5|RGF2_SCHPO Rho1 guanine nucleotide exchange factor 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rgf2 PE=1 SV=1 790 1155 2.0E-24
sp|Q06412|TUS1_YEAST Rho1 guanine nucleotide exchange factor TUS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUS1 PE=1 SV=1 685 1664 2.0E-23
sp|Q9UTR5|RGF2_SCHPO Rho1 guanine nucleotide exchange factor 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rgf2 PE=1 SV=1 1320 1619 1.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7U5|RGF3_SCHPO Rho1 guanine nucleotide exchange factor 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rgf3 PE=1 SV=1 706 1666 4.0E-103
sp|Q9Y7U6|RGF1_SCHPO Rho1 guanine nucleotide exchange factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rgf1 PE=1 SV=1 798 1625 1.0E-49
sp|Q9UTR5|RGF2_SCHPO Rho1 guanine nucleotide exchange factor 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rgf2 PE=1 SV=1 790 1155 2.0E-24
sp|Q06412|TUS1_YEAST Rho1 guanine nucleotide exchange factor TUS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUS1 PE=1 SV=1 685 1664 2.0E-23
sp|Q9UTR5|RGF2_SCHPO Rho1 guanine nucleotide exchange factor 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rgf2 PE=1 SV=1 1320 1619 1.0E-21
sp|P51862|ROM2_YEAST RHO1 GDP-GTP exchange protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ROM2 PE=1 SV=1 787 1146 7.0E-19
sp|P53046|ROM1_YEAST RHO1 GDP-GTP exchange protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ROM1 PE=1 SV=2 788 1159 5.0E-14
sp|Q5JSP0|FGD3_HUMAN FYVE, RhoGEF and PH domain-containing protein 3 OS=Homo sapiens GN=FGD3 PE=1 SV=1 863 1136 8.0E-12
sp|P51862|ROM2_YEAST RHO1 GDP-GTP exchange protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ROM2 PE=1 SV=1 1357 1616 1.0E-11
sp|Q8N5V2|NGEF_HUMAN Ephexin-1 OS=Homo sapiens GN=NGEF PE=1 SV=2 858 1124 1.0E-11
sp|Q5R5T1|FGD3_PONAB FYVE, RhoGEF and PH domain-containing protein 3 OS=Pongo abelii GN=FGD3 PE=2 SV=1 863 1136 1.0E-11
sp|Q5RDX5|NGEF_PONAB Ephexin-1 OS=Pongo abelii GN=NGEF PE=2 SV=1 858 1124 2.0E-11
sp|Q9N0A8|ARHG3_MACFA Rho guanine nucleotide exchange factor 3 OS=Macaca fascicularis GN=ARHGEF3 PE=2 SV=1 858 1156 5.0E-11
sp|Q9NR81|ARHG3_HUMAN Rho guanine nucleotide exchange factor 3 OS=Homo sapiens GN=ARHGEF3 PE=1 SV=1 858 1156 6.0E-11
sp|Q5R6F2|ARHG3_PONAB Rho guanine nucleotide exchange factor 3 OS=Pongo abelii GN=ARHGEF3 PE=2 SV=1 858 1156 1.0E-10
sp|Q8CHT1|NGEF_MOUSE Ephexin-1 OS=Mus musculus GN=Ngef PE=1 SV=1 858 1124 1.0E-10
sp|Q91X46|ARHG3_MOUSE Rho guanine nucleotide exchange factor 3 OS=Mus musculus GN=Arhgef3 PE=1 SV=1 858 1156 1.0E-10
sp|O88842|FGD3_MOUSE FYVE, RhoGEF and PH domain-containing protein 3 OS=Mus musculus GN=Fgd3 PE=1 SV=1 863 1137 2.0E-10
sp|Q5BKC9|NGEF_RAT Ephexin-1 OS=Rattus norvegicus GN=Ngef PE=1 SV=2 858 1124 4.0E-10
sp|Q553D3|GXCJJ_DICDI Rac guanine nucleotide exchange factor JJ OS=Dictyostelium discoideum GN=gxcJJ PE=1 SV=1 866 1070 3.0E-09
sp|Q9Z0R4|ITSN1_MOUSE Intersectin-1 OS=Mus musculus GN=Itsn1 PE=1 SV=2 859 1125 4.0E-09
sp|Q15811|ITSN1_HUMAN Intersectin-1 OS=Homo sapiens GN=ITSN1 PE=1 SV=3 859 1125 5.0E-09
sp|Q96DR7|ARHGQ_HUMAN Rho guanine nucleotide exchange factor 26 OS=Homo sapiens GN=ARHGEF26 PE=1 SV=4 732 1161 1.0E-08
sp|Q5ZLX4|ARHG3_CHICK Rho guanine nucleotide exchange factor 3 OS=Gallus gallus GN=Arhgef3 PE=2 SV=1 858 1156 1.0E-08
sp|Q96M96|FGD4_HUMAN FYVE, RhoGEF and PH domain-containing protein 4 OS=Homo sapiens GN=FGD4 PE=1 SV=2 853 1178 3.0E-08
sp|Q91ZT5|FGD4_MOUSE FYVE, RhoGEF and PH domain-containing protein 4 OS=Mus musculus GN=Fgd4 PE=1 SV=1 853 1118 3.0E-08
sp|Q7Z6J4|FGD2_HUMAN FYVE, RhoGEF and PH domain-containing protein 2 OS=Homo sapiens GN=FGD2 PE=1 SV=1 804 1072 4.0E-08
sp|Q11100|TAG52_CAEEL Putative protein tag-52 OS=Caenorhabditis elegans GN=tag-52 PE=3 SV=1 861 1118 5.0E-08
sp|P52734|FGD1_MOUSE FYVE, RhoGEF and PH domain-containing protein 1 OS=Mus musculus GN=Fgd1 PE=1 SV=2 824 1118 1.0E-07
sp|O88387|FGD4_RAT FYVE, RhoGEF and PH domain-containing protein 4 OS=Rattus norvegicus GN=Fgd4 PE=1 SV=1 853 1118 2.0E-07
sp|P98174|FGD1_HUMAN FYVE, RhoGEF and PH domain-containing protein 1 OS=Homo sapiens GN=FGD1 PE=1 SV=2 864 1118 3.0E-07
sp|O15085|ARHGB_HUMAN Rho guanine nucleotide exchange factor 11 OS=Homo sapiens GN=ARHGEF11 PE=1 SV=1 842 1060 3.0E-07
sp|Q9NZM3|ITSN2_HUMAN Intersectin-2 OS=Homo sapiens GN=ITSN2 PE=1 SV=3 859 1120 5.0E-07
sp|Q9Z0R6|ITSN2_MOUSE Intersectin-2 OS=Mus musculus GN=Itsn2 PE=1 SV=2 859 1123 6.0E-07
sp|Q55E26|GXCB_DICDI Rac guanine nucleotide exchange factor B OS=Dictyostelium discoideum GN=gxcB PE=2 SV=1 859 1079 6.0E-07
sp|Q8C033|ARHGA_MOUSE Rho guanine nucleotide exchange factor 10 OS=Mus musculus GN=Arhgef10 PE=1 SV=2 853 1070 4.0E-06
sp|Q8BY35|FGD2_MOUSE FYVE, RhoGEF and PH domain-containing protein 2 OS=Mus musculus GN=Fgd2 PE=1 SV=1 858 1059 5.0E-06
sp|O15013|ARHGA_HUMAN Rho guanine nucleotide exchange factor 10 OS=Homo sapiens GN=ARHGEF10 PE=1 SV=4 853 1070 5.0E-06
sp|Q9ES67|ARHGB_RAT Rho guanine nucleotide exchange factor 11 OS=Rattus norvegicus GN=Arhgef11 PE=1 SV=1 842 1060 6.0E-06
sp|Q69ZL1|FGD6_MOUSE FYVE, RhoGEF and PH domain-containing protein 6 OS=Mus musculus GN=Fgd6 PE=1 SV=2 864 1104 6.0E-06
sp|Q69ZK0|PREX1_MOUSE Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein OS=Mus musculus GN=Prex1 PE=1 SV=2 862 1121 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005085 guanyl-nucleotide exchange factor activity Yes
GO:0030695 GTPase regulator activity No
GO:0098772 molecular function regulator activity No
GO:0003674 molecular_function No
GO:0060589 nucleoside-triphosphatase regulator activity No
GO:0030234 enzyme regulator activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4180
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3570
Ophiocordyceps australis map64 (Brazil) OphauB2|3105 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|00828
Ophiocordyceps camponoti-rufipedis Ophun1|5526
Ophiocordyceps kimflemingae Ophio5|4728
Ophiocordyceps subramaniannii Hirsu2|8490

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3105
MSFRGDDERRYGQVPPVRYPVSARPAIAPSSSLDSGDDIPPHASPGRHHEGPGFQSPMPDELFMTSPTASAPGYQ
QRNNRDATCPTPTSTRTYNPQSYAHSSNAAFARSPSATLPHHVPPAPRHAANSLSTSPPARYASSSYNPAVYAGT
NGPQRQPTYPGHSLHQTSPNHGHSPAASYSNTSPQPLQSPTRSSGFQQSNANSPSSPRSQPPTPVYDPLYYAASH
HMSCHNSNAGTHNSTPYPINSQIPVGPNYQTNDDESFYSTQPPCRSTSFVQSHSPPGLQRHPTNAPLPSRPTDVF
ADEAPYWDSNGRPLGSDYSTERITQDTIMQEIEAELDGPSHRARPLPPSPVNGHGGSDHDAEARRRNSSGAGSRS
PLSRRRSPITSHGYGGGRQLFDEADDDDDDAEGAAGVLAMHEAELEDKRFNGNTIMHSQFPPTLHSNRSPLPRRP
EEESFVDDDLGGVVDLGALSGGYAANLTYGTTSWNVPMQESTRPLPTPAGYNSLREVCDKVYENAPGFRNADMDY
VGTGGLQSPRVQRLSFEQGGEEKALVDSWQQNGSESPAKDDIQDLFYHPGLSNRPLPALPRGTGSDSSSYLSAQH
SHWGQDQPSAAQGDSLEAVTGPERSISLCGHSNTRQVQAPARSRTDAAEERKKMARQQHQALSPHGTTFSDYDAT
ASAASGAFDSITLPSGRKKKFTPCKLTAGDFARCGEAWALSGLEAWIRDMAEGEMDLRGKTIQEALINLFDFKVP
TMKRVDMEAFSGHVVEQMLEAGVLVAEEEWVKFGQGHISGVWYAMTRGGCYTARLHDYDHSGLCYAPRCERRVVP
EAEEEESEEAGKQVDWNVFHNLSKEEWESKPKKEVERQNILHEIVSGEENYMKQLDIFRKLYLVELQTRKPAIIH
PERRDKFLGAVFGKLEKVIEVNRQHLLLPLCFRRKEQGPWIVGFSDIFREWIRKAKKEYIEYASGFPRASWMVRK
EAERNIVFSKFLAEQRKDKRSAKQDWTHFIIGPLQRLQRYILLLESVEHKMAEESEEKTNQQRAIEEIKAVTSEC
DSKVAEQERRITMMQLDRELVLRPGFQSVLNLDHLGRLLIMRGDLQRMGSKGMRWVDTHAILFDHYLILAKVLFP
KEARTERKYDVSKEPIPMPLLCLESVNDEPVTKQKGITAPLGRTTAAAAASAQMHKATGSGGLEQTPTGSSTTTL
APAASNDAEGKTLYPFKVKHLGHETYTLYASMARDRNDWCRSILDAKTRHAKALHSQNAEPFRLRVLADASFHYD
GSATSARPPGVSVKGTPLDRALHEIEATLGSAQGTGPVCRAHVNCAAGFVLANRAMIVIGTDYGIFVSDTNEPRA
WRRVYKVTQIAVLEDFSLCLVIADKSLVSFPLDVVAPTSDFARPLNDNPRNAPQRLAKDVSYFATARMKGRMLVF
YKRKEGLHTSFKVLEPVVHKATEKRLRLFGGRKGAVISGGHTESFRDFDEFYLPTECYSLSLFHTYIAVATAKGI
EMLTLDKKQPMSIPDLKAPGTVNIAGRIRDQRPLGMFRLNDSEFILTYEDCAVYVDKHGDVSRTLIMEYTGKQKK
ARGATMYGQYLLLFNDDYVEVRNADNGRLRQIIAGRDVRVIDYGMRGPTGSSTAPLMTPTNGKRPSQISKGTVKI
AMSHPELPGRQIILEMLLNDGLAE*
Coding >OphauB2|3105
ATGTCGTTCCGGGGCGATGACGAGCGCCGCTACGGCCAAGTGCCGCCTGTCCGCTACCCCGTTTCTGCCCGCCCT
GCCATTGCGCCCAGTTCCAGCTTGGACTCGGGCGACGACATTCCCCCCCACGCCTCCCCGGGGCGCCACCACGAG
GGGCCCGGCTTCCAGTCTCCCATGCCAGACGAGCTCTTCATGACGAGCCCCACGGCCAGCGCGCCTGGTTATCAA
CAGCGCAACAACCGCGACGCGACATGTCCTACGCCGACGTCGACAAGGACGTACAATCCTCAATCCTATGCCCAT
TCGTCCAATGCCGCCTTTGCACGCTCTCCGTCGGCGACGCTCCCCCATCACGTCCCCCCGGCGCCGCGACATGCC
GCCAACTCGTTGAGCACTTCTCCGCCAGCGCGCTATGCCTCGTCGTCGTATAATCCGGCTGTTTATGCCGGCACC
AACGGGCCCCAGAGACAGCCTACCTACCCCGGACACAGCCTGCATCAGACATCACCTAACCATGGGCATTCCCCT
GCAGCGAGCTATTCGAATACATCGCCTCAGCCTCTACAGTCTCCCACGCGCTCGTCTGGCTTCCAGCAGTCGAAT
GCCAACAGTCCGTCGTCGCCCCGCTCGCAGCCACCAACGCCTGTCTACGACCCTTTATACTATGCCGCGAGCCAC
CACATGTCTTGTCACAACTCAAATGCTGGCACGCACAACTCGACGCCGTACCCCATCAACTCACAGATACCCGTG
GGACCCAACTACCAGACCAATGACGACGAATCATTTTACAGCACTCAGCCTCCCTGTCGATCCACCTCGTTTGTG
CAGTCGCATTCTCCGCCAGGCCTGCAAAGGCATCCCACCAATGCTCCTCTGCCCAGCCGTCCAACTGACGTATTT
GCCGACGAAGCACCATACTGGGATTCCAACGGGCGTCCTCTTGGAAGCGACTACAGCACGGAGCGCATAACCCAG
GACACCATTATGCAGGAGATTGAGGCCGAATTGGACGGACCAAGCCACCGAGCGCGGCCACTGCCGCCATCTCCA
GTCAACGGCCATGGCGGATCCGACCATGATGCCGAGGCGCGGCGGCGGAATAGCTCGGGTGCAGGGTCGCGCTCT
CCGCTCAGCCGTCGACGATCGCCCATTACAAGCCATGGCTATGGCGGAGGGCGGCAATTGTTTGACGAGGCCGAC
GACGACGATGACGATGCCGAGGGTGCTGCAGGCGTCTTGGCCATGCACGAGGCAGAACTGGAGGACAAGCGTTTC
AATGGCAATACAATTATGCACAGCCAGTTCCCACCCACGTTGCACTCGAACCGCTCGCCCCTGCCGCGGCGGCCA
GAAGAGGAAAGCTTTGTCGACGACGACCTGGGCGGAGTGGTTGACTTGGGGGCCTTGAGCGGAGGCTATGCGGCC
AACCTGACCTATGGCACCACGTCATGGAATGTGCCCATGCAGGAGAGCACGCGGCCACTGCCCACTCCAGCTGGT
TACAACTCGCTGCGCGAGGTGTGCGACAAGGTGTATGAGAATGCGCCTGGCTTCCGCAATGCAGACATGGACTAT
GTTGGCACTGGCGGCCTGCAATCGCCCAGGGTGCAGAGACTAAGCTTTGAGCAAGGCGGCGAGGAAAAGGCGTTG
GTGGACTCGTGGCAGCAGAATGGCTCCGAGTCGCCTGCAAAGGACGATATCCAAGACCTCTTCTACCATCCCGGG
CTGAGCAACAGGCCGCTGCCAGCGCTGCCGCGAGGCACAGGGTCGGATAGCAGCTCATACCTGTCGGCGCAGCAC
AGCCATTGGGGCCAAGACCAGCCCTCTGCGGCGCAGGGGGACAGCTTGGAGGCGGTGACGGGCCCCGAGAGGTCG
ATTTCATTATGCGGACACAGCAACACGCGTCAGGTTCAGGCGCCGGCCAGGTCGCGGACCGACGCTGCTGAGGAA
CGCAAGAAAATGGCCAGACAGCAGCATCAGGCGCTTTCTCCGCATGGGACGACGTTTTCGGACTACGACGCAACG
GCGAGCGCTGCGTCTGGGGCATTTGACAGCATCACGCTGCCGAGTGGGCGCAAGAAGAAGTTTACGCCGTGCAAG
CTGACAGCGGGCGACTTTGCCAGGTGTGGGGAGGCGTGGGCGCTGAGCGGGCTGGAGGCGTGGATACGGGACATG
GCAGAGGGCGAAATGGATCTGCGGGGCAAGACGATCCAAGAGGCCCTCATCAACCTGTTTGACTTCAAGGTGCCG
ACGATGAAGCGAGTGGACATGGAGGCGTTTAGCGGGCATGTTGTGGAGCAGATGCTTGAAGCCGGGGTGCTGGTG
GCGGAGGAGGAATGGGTCAAGTTTGGGCAGGGGCACATTTCGGGAGTGTGGTATGCCATGACAAGAGGCGGCTGC
TACACGGCCAGGCTGCACGACTATGACCACTCTGGACTGTGCTATGCGCCGCGGTGCGAGCGGCGAGTGGTTCCC
GAGGCGGAGGAGGAGGAGTCTGAAGAGGCGGGCAAGCAGGTGGACTGGAACGTCTTCCACAACCTGAGCAAGGAG
GAGTGGGAGAGCAAGCCCAAGAAGGAGGTGGAGCGGCAGAACATCCTGCACGAGATTGTCAGCGGGGAGGAAAAC
TACATGAAGCAACTCGACATCTTCCGCAAGCTCTATCTGGTGGAGCTGCAGACGCGCAAGCCGGCCATTATCCAC
CCCGAGCGGCGCGACAAGTTCCTGGGGGCGGTGTTTGGCAAGCTGGAAAAGGTGATTGAGGTCAACAGGCAGCAC
CTGCTGCTCCCGCTGTGCTTTCGGCGCAAGGAGCAGGGGCCGTGGATTGTGGGCTTCAGCGACATTTTCCGCGAG
TGGATCCGCAAGGCCAAGAAGGAGTATATCGAGTATGCGTCTGGCTTCCCGCGGGCGTCGTGGATGGTGCGCAAG
GAGGCGGAGCGCAACATTGTGTTTAGCAAGTTTCTGGCAGAGCAGCGCAAGGACAAGCGGTCGGCCAAGCAGGAC
TGGACGCACTTCATCATTGGGCCGCTGCAGCGGCTGCAGCGCTACATCCTGCTGCTGGAGAGCGTGGAGCACAAG
ATGGCGGAGGAGAGCGAGGAGAAGACGAACCAGCAGCGGGCGATTGAGGAGATCAAGGCGGTGACGAGCGAGTGC
GACTCCAAGGTGGCGGAGCAGGAGCGGCGCATCACCATGATGCAGCTGGACCGCGAGCTGGTGCTGCGGCCGGGC
TTCCAGTCGGTGCTCAACCTGGACCACCTGGGGCGGCTGCTGATTATGCGCGGCGACCTGCAGCGCATGGGATCC
AAGGGCATGCGCTGGGTGGACACGCACGCCATTCTCTTTGACCACTACTTGATTCTCGCCAAGGTGCTCTTCCCC
AAGGAGGCGCGCACGGAGCGCAAGTACGACGTGTCCAAGGAGCCCATTCCCATGCCGCTGCTGTGTCTGGAGAGC
GTCAACGACGAGCCTGTGACCAAGCAAAAGGGCATCACGGCGCCGCTGGGACGCACCACGGCGGCCGCGGCAGCC
TCGGCGCAGATGCACAAGGCCACGGGCAGCGGCGGGCTGGAGCAGACGCCCACCGGCTCCTCCACCACCACGCTG
GCCCCGGCCGCCTCCAACGACGCCGAGGGCAAGACGCTCTATCCCTTCAAGGTGAAGCACCTGGGCCACGAGACA
TACACGCTCTACGCCTCCATGGCGCGTGACCGCAACGACTGGTGCCGCAGCATCCTCGACGCCAAGACGCGCCAC
GCAAAGGCGCTGCACTCGCAAAACGCCGAGCCCTTTCGCCTGCGCGTCCTGGCCGACGCCTCCTTCCACTACGAC
GGCAGCGCCACCAGCGCGCGGCCCCCGGGCGTCTCGGTCAAGGGCACGCCTCTGGACCGCGCTCTGCACGAAATC
GAAGCCACGCTGGGCTCGGCTCAGGGCACTGGGCCCGTCTGTCGCGCCCATGTCAACTGCGCCGCCGGCTTTGTC
CTTGCCAACCGCGCCATGATTGTCATTGGCACCGACTATGGCATTTTTGTCTCGGACACGAATGAGCCGCGGGCC
TGGCGTCGGGTCTACAAGGTGACGCAAATCGCCGTCCTCGAAGACTTCTCCCTCTGCCTCGTCATTGCCGACAAG
TCGCTCGTCTCCTTTCCCCTCGATGTCGTCGCCCCCACTTCCGACTTTGCTCGGCCCCTCAACGACAACCCTCGC
AACGCCCCCCAGCGCCTGGCCAAGGACGTCAGCTACTTTGCCACAGCCCGCATGAAGGGCCGCATGCTCGTCTTC
TACAAGCGCAAGGAGGGCTTGCACACCTCGTTCAAGGTGCTCGAGCCCGTCGTCCACAAGGCCACCGAGAAGCGC
CTGCGTCTCTTTGGCGGCCGCAAAGGCGCCGTCATCAGCGGAGGCCACACCGAGTCCTTTCGCGACTTTGACGAG
TTCTACCTGCCCACCGAGTGCTACTCGCTCAGCCTCTTCCACACCTACATTGCTGTCGCCACCGCAAAGGGCATC
GAGATGCTGACCCTCGACAAGAAGCAGCCCATGTCCATCCCCGACCTCAAGGCCCCCGGCACCGTCAACATTGCT
GGCCGCATCCGCGATCAGCGGCCCCTTGGCATGTTTCGTCTCAACGACAGCGAGTTTATCCTCACCTACGAGGAC
TGTGCCGTCTATGTCGACAAGCACGGCGACGTCAGCCGCACCCTCATCATGGAGTACACGGGCAAGCAGAAAAAG
GCTCGCGGCGCCACCATGTACGGCCAGTATCTGCTGCTCTTCAACGACGACTATGTCGAGGTGCGCAACGCCGAC
AATGGCCGCCTGCGCCAAATCATTGCTGGCCGCGACGTACGCGTCATTGACTATGGCATGAGGGGCCCTACCGGC
TCCTCTACCGCTCCCCTCATGACCCCCACCAACGGCAAAAGACCCAGCCAAATCTCCAAGGGCACCGTCAAAATC
GCCATGAGCCACCCCGAGCTGCCGGGCAGGCAGATTATCCTTGAGATGCTTCTCAACGACGGCCTTGCCGAGTAG
Transcript >OphauB2|3105
ATGTCGTTCCGGGGCGATGACGAGCGCCGCTACGGCCAAGTGCCGCCTGTCCGCTACCCCGTTTCTGCCCGCCCT
GCCATTGCGCCCAGTTCCAGCTTGGACTCGGGCGACGACATTCCCCCCCACGCCTCCCCGGGGCGCCACCACGAG
GGGCCCGGCTTCCAGTCTCCCATGCCAGACGAGCTCTTCATGACGAGCCCCACGGCCAGCGCGCCTGGTTATCAA
CAGCGCAACAACCGCGACGCGACATGTCCTACGCCGACGTCGACAAGGACGTACAATCCTCAATCCTATGCCCAT
TCGTCCAATGCCGCCTTTGCACGCTCTCCGTCGGCGACGCTCCCCCATCACGTCCCCCCGGCGCCGCGACATGCC
GCCAACTCGTTGAGCACTTCTCCGCCAGCGCGCTATGCCTCGTCGTCGTATAATCCGGCTGTTTATGCCGGCACC
AACGGGCCCCAGAGACAGCCTACCTACCCCGGACACAGCCTGCATCAGACATCACCTAACCATGGGCATTCCCCT
GCAGCGAGCTATTCGAATACATCGCCTCAGCCTCTACAGTCTCCCACGCGCTCGTCTGGCTTCCAGCAGTCGAAT
GCCAACAGTCCGTCGTCGCCCCGCTCGCAGCCACCAACGCCTGTCTACGACCCTTTATACTATGCCGCGAGCCAC
CACATGTCTTGTCACAACTCAAATGCTGGCACGCACAACTCGACGCCGTACCCCATCAACTCACAGATACCCGTG
GGACCCAACTACCAGACCAATGACGACGAATCATTTTACAGCACTCAGCCTCCCTGTCGATCCACCTCGTTTGTG
CAGTCGCATTCTCCGCCAGGCCTGCAAAGGCATCCCACCAATGCTCCTCTGCCCAGCCGTCCAACTGACGTATTT
GCCGACGAAGCACCATACTGGGATTCCAACGGGCGTCCTCTTGGAAGCGACTACAGCACGGAGCGCATAACCCAG
GACACCATTATGCAGGAGATTGAGGCCGAATTGGACGGACCAAGCCACCGAGCGCGGCCACTGCCGCCATCTCCA
GTCAACGGCCATGGCGGATCCGACCATGATGCCGAGGCGCGGCGGCGGAATAGCTCGGGTGCAGGGTCGCGCTCT
CCGCTCAGCCGTCGACGATCGCCCATTACAAGCCATGGCTATGGCGGAGGGCGGCAATTGTTTGACGAGGCCGAC
GACGACGATGACGATGCCGAGGGTGCTGCAGGCGTCTTGGCCATGCACGAGGCAGAACTGGAGGACAAGCGTTTC
AATGGCAATACAATTATGCACAGCCAGTTCCCACCCACGTTGCACTCGAACCGCTCGCCCCTGCCGCGGCGGCCA
GAAGAGGAAAGCTTTGTCGACGACGACCTGGGCGGAGTGGTTGACTTGGGGGCCTTGAGCGGAGGCTATGCGGCC
AACCTGACCTATGGCACCACGTCATGGAATGTGCCCATGCAGGAGAGCACGCGGCCACTGCCCACTCCAGCTGGT
TACAACTCGCTGCGCGAGGTGTGCGACAAGGTGTATGAGAATGCGCCTGGCTTCCGCAATGCAGACATGGACTAT
GTTGGCACTGGCGGCCTGCAATCGCCCAGGGTGCAGAGACTAAGCTTTGAGCAAGGCGGCGAGGAAAAGGCGTTG
GTGGACTCGTGGCAGCAGAATGGCTCCGAGTCGCCTGCAAAGGACGATATCCAAGACCTCTTCTACCATCCCGGG
CTGAGCAACAGGCCGCTGCCAGCGCTGCCGCGAGGCACAGGGTCGGATAGCAGCTCATACCTGTCGGCGCAGCAC
AGCCATTGGGGCCAAGACCAGCCCTCTGCGGCGCAGGGGGACAGCTTGGAGGCGGTGACGGGCCCCGAGAGGTCG
ATTTCATTATGCGGACACAGCAACACGCGTCAGGTTCAGGCGCCGGCCAGGTCGCGGACCGACGCTGCTGAGGAA
CGCAAGAAAATGGCCAGACAGCAGCATCAGGCGCTTTCTCCGCATGGGACGACGTTTTCGGACTACGACGCAACG
GCGAGCGCTGCGTCTGGGGCATTTGACAGCATCACGCTGCCGAGTGGGCGCAAGAAGAAGTTTACGCCGTGCAAG
CTGACAGCGGGCGACTTTGCCAGGTGTGGGGAGGCGTGGGCGCTGAGCGGGCTGGAGGCGTGGATACGGGACATG
GCAGAGGGCGAAATGGATCTGCGGGGCAAGACGATCCAAGAGGCCCTCATCAACCTGTTTGACTTCAAGGTGCCG
ACGATGAAGCGAGTGGACATGGAGGCGTTTAGCGGGCATGTTGTGGAGCAGATGCTTGAAGCCGGGGTGCTGGTG
GCGGAGGAGGAATGGGTCAAGTTTGGGCAGGGGCACATTTCGGGAGTGTGGTATGCCATGACAAGAGGCGGCTGC
TACACGGCCAGGCTGCACGACTATGACCACTCTGGACTGTGCTATGCGCCGCGGTGCGAGCGGCGAGTGGTTCCC
GAGGCGGAGGAGGAGGAGTCTGAAGAGGCGGGCAAGCAGGTGGACTGGAACGTCTTCCACAACCTGAGCAAGGAG
GAGTGGGAGAGCAAGCCCAAGAAGGAGGTGGAGCGGCAGAACATCCTGCACGAGATTGTCAGCGGGGAGGAAAAC
TACATGAAGCAACTCGACATCTTCCGCAAGCTCTATCTGGTGGAGCTGCAGACGCGCAAGCCGGCCATTATCCAC
CCCGAGCGGCGCGACAAGTTCCTGGGGGCGGTGTTTGGCAAGCTGGAAAAGGTGATTGAGGTCAACAGGCAGCAC
CTGCTGCTCCCGCTGTGCTTTCGGCGCAAGGAGCAGGGGCCGTGGATTGTGGGCTTCAGCGACATTTTCCGCGAG
TGGATCCGCAAGGCCAAGAAGGAGTATATCGAGTATGCGTCTGGCTTCCCGCGGGCGTCGTGGATGGTGCGCAAG
GAGGCGGAGCGCAACATTGTGTTTAGCAAGTTTCTGGCAGAGCAGCGCAAGGACAAGCGGTCGGCCAAGCAGGAC
TGGACGCACTTCATCATTGGGCCGCTGCAGCGGCTGCAGCGCTACATCCTGCTGCTGGAGAGCGTGGAGCACAAG
ATGGCGGAGGAGAGCGAGGAGAAGACGAACCAGCAGCGGGCGATTGAGGAGATCAAGGCGGTGACGAGCGAGTGC
GACTCCAAGGTGGCGGAGCAGGAGCGGCGCATCACCATGATGCAGCTGGACCGCGAGCTGGTGCTGCGGCCGGGC
TTCCAGTCGGTGCTCAACCTGGACCACCTGGGGCGGCTGCTGATTATGCGCGGCGACCTGCAGCGCATGGGATCC
AAGGGCATGCGCTGGGTGGACACGCACGCCATTCTCTTTGACCACTACTTGATTCTCGCCAAGGTGCTCTTCCCC
AAGGAGGCGCGCACGGAGCGCAAGTACGACGTGTCCAAGGAGCCCATTCCCATGCCGCTGCTGTGTCTGGAGAGC
GTCAACGACGAGCCTGTGACCAAGCAAAAGGGCATCACGGCGCCGCTGGGACGCACCACGGCGGCCGCGGCAGCC
TCGGCGCAGATGCACAAGGCCACGGGCAGCGGCGGGCTGGAGCAGACGCCCACCGGCTCCTCCACCACCACGCTG
GCCCCGGCCGCCTCCAACGACGCCGAGGGCAAGACGCTCTATCCCTTCAAGGTGAAGCACCTGGGCCACGAGACA
TACACGCTCTACGCCTCCATGGCGCGTGACCGCAACGACTGGTGCCGCAGCATCCTCGACGCCAAGACGCGCCAC
GCAAAGGCGCTGCACTCGCAAAACGCCGAGCCCTTTCGCCTGCGCGTCCTGGCCGACGCCTCCTTCCACTACGAC
GGCAGCGCCACCAGCGCGCGGCCCCCGGGCGTCTCGGTCAAGGGCACGCCTCTGGACCGCGCTCTGCACGAAATC
GAAGCCACGCTGGGCTCGGCTCAGGGCACTGGGCCCGTCTGTCGCGCCCATGTCAACTGCGCCGCCGGCTTTGTC
CTTGCCAACCGCGCCATGATTGTCATTGGCACCGACTATGGCATTTTTGTCTCGGACACGAATGAGCCGCGGGCC
TGGCGTCGGGTCTACAAGGTGACGCAAATCGCCGTCCTCGAAGACTTCTCCCTCTGCCTCGTCATTGCCGACAAG
TCGCTCGTCTCCTTTCCCCTCGATGTCGTCGCCCCCACTTCCGACTTTGCTCGGCCCCTCAACGACAACCCTCGC
AACGCCCCCCAGCGCCTGGCCAAGGACGTCAGCTACTTTGCCACAGCCCGCATGAAGGGCCGCATGCTCGTCTTC
TACAAGCGCAAGGAGGGCTTGCACACCTCGTTCAAGGTGCTCGAGCCCGTCGTCCACAAGGCCACCGAGAAGCGC
CTGCGTCTCTTTGGCGGCCGCAAAGGCGCCGTCATCAGCGGAGGCCACACCGAGTCCTTTCGCGACTTTGACGAG
TTCTACCTGCCCACCGAGTGCTACTCGCTCAGCCTCTTCCACACCTACATTGCTGTCGCCACCGCAAAGGGCATC
GAGATGCTGACCCTCGACAAGAAGCAGCCCATGTCCATCCCCGACCTCAAGGCCCCCGGCACCGTCAACATTGCT
GGCCGCATCCGCGATCAGCGGCCCCTTGGCATGTTTCGTCTCAACGACAGCGAGTTTATCCTCACCTACGAGGAC
TGTGCCGTCTATGTCGACAAGCACGGCGACGTCAGCCGCACCCTCATCATGGAGTACACGGGCAAGCAGAAAAAG
GCTCGCGGCGCCACCATGTACGGCCAGTATCTGCTGCTCTTCAACGACGACTATGTCGAGGTGCGCAACGCCGAC
AATGGCCGCCTGCGCCAAATCATTGCTGGCCGCGACGTACGCGTCATTGACTATGGCATGAGGGGCCCTACCGGC
TCCTCTACCGCTCCCCTCATGACCCCCACCAACGGCAAAAGACCCAGCCAAATCTCCAAGGGCACCGTCAAAATC
GCCATGAGCCACCCCGAGCTGCCGGGCAGGCAGATTATCCTTGAGATGCTTCTCAACGACGGCCTTGCCGAGTAG
Gene >OphauB2|3105
ATGTCGTTCCGGGGCGATGACGAGCGCCGCTACGGCCAAGTGCCGCCTGTCCGCTACCCCGTTTCTGCCCGCCCT
GCCATTGCGCCCAGTTCCAGCTTGGACTCGGGCGACGACATTCCCCCCCACGCCTCCCCGGGGCGCCACCACGAG
GGGCCCGGCTTCCAGTCTCCCATGCCAGACGAGCTCTTCATGACGAGCCCCACGGCCAGCGCGCCTGGTTATCAA
CAGCGCAACAACCGCGACGCGACATGTCCTACGCCGACGTCGACAAGGACGTACAATCCTCAATCCTATGCCCAT
TCGTCCAATGCCGCCTTTGCACGCTCTCCGTCGGCGACGCTCCCCCATCACGTCCCCCCGGCGCCGCGACATGCC
GCCAACTCGTTGAGCACTTCTCCGCCAGCGCGCTATGCCTCGTCGTCGTATAATCCGGCTGTTTATGCCGGCACC
AACGGGCCCCAGAGACAGCCTACCTACCCCGGACACAGCCTGCATCAGACATCACCTAACCATGGGCATTCCCCT
GCAGCGAGCTATTCGAATACATCGCCTCAGCCTCTACAGTCTCCCACGCGCTCGTCTGGCTTCCAGCAGTCGAAT
GCCAACAGTCCGTCGTCGCCCCGCTCGCAGCCACCAACGCCTGTCTACGACCCTTTATACTATGCCGCGAGCCAC
CACATGTCTTGTCACAACTCAAATGCTGGCACGCACAACTCGACGCCGTACCCCATCAACTCACAGATACCCGTG
GGACCCAACTACCAGACCAATGACGACGAATCATTTTACAGCACTCAGCCTCCCTGTCGATCCACCTCGTTTGTG
CAGTCGCATTCTCCGCCAGGCCTGCAAAGGCATCCCACCAATGCTCCTCTGCCCAGCCGTCCAACTGACGTATTT
GCCGACGAAGCACCATACTGGGATTCCAACGGGCGTCCTCTTGGAAGCGACTACAGCACGGAGCGCATAACCCAG
GACACCATTATGCAGGAGATTGAGGCCGAATTGGACGGACCAAGCCACCGAGCGCGGCCACTGCCGCCATCTCCA
GTCAACGGCCATGGCGGATCCGACCATGATGCCGAGGCGCGGCGGCGGAATAGCTCGGGTGCAGGGTCGCGCTCT
CCGCTCAGCCGTCGACGATCGCCCATTACAAGCCATGGCTATGGCGGAGGGCGGCAATTGTTTGACGAGGCCGAC
GACGACGATGACGATGCCGAGGGTGCTGCAGGCGTCTTGGCCATGCACGAGGCAGAACTGGAGGACAAGCGTTTC
AATGGCAATACAATTATGCACAGCCAGTTCCCACCCACGTTGCACTCGAACCGCTCGCCCCTGCCGCGGCGGCCA
GAAGAGGAAAGCTTTGTCGACGACGACCTGGGCGGAGTGGTTGACTTGGGGGCCTTGAGCGGAGGCTATGCGGCC
AACCTGACCTATGGCACCACGTCATGGAATGTGCCCATGCAGGAGAGCACGCGGCCACTGCCCACTCCAGCTGGT
TACAACTCGCTGCGCGAGGTGTGCGACAAGGTGTATGAGAATGCGCCTGGCTTCCGCAATGCAGACATGGACTAT
GTTGGCACTGGCGGCCTGCAATCGCCCAGGGTGCAGAGACTAAGCTTTGAGCAAGGCGGCGAGGAAAAGGCGTTG
GTGGACTCGTGGCAGCAGAATGGCTCCGAGTCGCCTGCAAAGGACGATATCCAAGACCTCTTCTACCATCCCGGG
CTGAGCAACAGGCCGCTGCCAGCGCTGCCGCGAGGCACAGGGTCGGATAGCAGCTCATACCTGTCGGCGCAGCAC
AGCCATTGGGGCCAAGACCAGCCCTCTGCGGCGCAGGGGGACAGCTTGGAGGCGGTGACGGGCCCCGAGAGGTCG
ATTTCATTATGCGGACACAGCAACACGCGTCAGGTTCAGGCGCCGGCCAGGTCGCGGACCGACGCTGCTGAGGAA
CGCAAGAAAATGGCCAGACAGCAGCATCAGGCGCTTTCTCCGCATGGGACGACGTTTTCGGACTACGACGCAACG
GCGAGCGCTGCGTCTGGGGCATTTGACAGCATCACGCTGCCGAGTGGGCGCAAGAAGAAGTTTACGCCGTGCAAG
CTGACAGCGGGCGACTTTGCCAGGTGTGGGGAGGCGTGGGCGCTGAGCGGGCTGGAGGCGTGGATACGGGACATG
GCAGAGGGCGAAATGGATCTGCGGGGCAAGACGATCCAAGAGGCCCTCATCAACCTGTTTGACTTCAAGGTGCCG
ACGATGAAGCGAGTGGACATGGAGGCGTTTAGCGGGCATGTTGTGGAGCAGATGCTTGAAGCCGGGGTGCTGGTG
GCGGAGGAGGAATGGGTCAAGTTTGGGCAGGGGCACATTTCGGGAGTGTGGTATGCCATGACAAGAGGCGGCTGC
TACACGGCCAGGCTGCACGACTATGACCACTCTGGACTGTGCTATGCGCCGCGGTGCGAGCGGCGAGTGGTTCCC
GAGGCGGAGGAGGAGGAGTCTGAAGAGGCGGGCAAGCAGGTGGACTGGAACGTCTTCCACAACCTGAGCAAGGAG
GAGTGGGAGAGCAAGCCCAAGAAGGAGGTGGAGCGGCAGAACATCCTGCACGAGATTGTCAGCGGGGAGGAAAAC
TACATGAAGCAACTCGACATCTTCCGCAAGCTCTATCTGGTGGAGCTGCAGACGCGCAAGCCGGCCATTATCCAC
CCCGAGCGGCGCGACAAGTTCCTGGGGGCGGTGTTTGGCAAGCTGGAAAAGGTGATTGAGGTCAACAGGCAGCAC
CTGCTGCTCCCGCTGTGCTTTCGGCGCAAGGAGCAGGGGCCGTGGATTGTGGGCTTCAGCGACATTTTCCGCGAG
TGGATCCGCAAGGCCAAGAAGGAGTATATCGAGTATGCGTCTGGCTTCCCGCGGGCGTCGTGGATGGTGCGCAAG
GAGGCGGAGCGCAACATTGTGTTTAGCAAGTTTCTGGCAGAGCAGCGCAAGGACAAGCGGTCGGCCAAGCAGGAC
TGGACGCACTTCATCATTGGGCCGCTGCAGCGGCTGCAGCGCTACATCCTGCTGCTGGAGAGCGTGGAGCACAAG
ATGGCGGAGGAGAGCGAGGAGAAGACGAACCAGCAGCGGGCGATTGAGGAGATCAAGGCGGTGACGAGCGAGTGC
GACTCCAAGGTGGCGGAGCAGGAGCGGCGCATCACCATGATGCAGCTGGACCGCGAGCTGGTGCTGCGGCCGGGC
TTCCAGTCGGTGCTCAACCTGGACCACCTGGGGCGGCTGCTGATTATGCGCGGCGACCTGCAGCGCATGGGATCC
AAGGGCATGCGCTGGGTGGACACGCACGCCATTCTCTTTGACCACTACTTGATTCTCGCCAAGGTGCTCTTCCCC
AAGGAGGCGCGCACGGAGCGCAAGTACGACGTGTCCAAGGAGCCCATTCCCATGCCGCTGCTGTGTCTGGAGAGC
GTCAACGACGAGCCTGTGACCAAGCAAAAGGGCATCACGGCGCCGCTGGGACGCACCACGGCGGCCGCGGCAGCC
TCGGCGCAGATGCACAAGGCCACGGGCAGCGGCGGGCTGGAGCAGACGCCCACCGGCTCCTCCACCACCACGCTG
GCCCCGGCCGCCTCCAACGACGCCGAGGGCAAGACGCTCTATCCCTTCAAGGTGAAGCACCTGGGCCACGAGACA
TACACGCTCTACGCCTCCATGGCGCGTGACCGCAACGACTGGTGCCGCAGCATCCTCGACGCCAAGACGCGCCAC
GCAAAGGCGCTGCACTCGCAAAACGCCGAGCCCTTTCGCCTGCGCGTCCTGGCCGACGCCTCCTTCCACTACGAC
GGCAGCGCCACCAGCGCGCGGCCCCCGGGCGTCTCGGTCAAGGGCACGCCTCTGGACCGCGCTCTGCACGAAATC
GAAGCCACGCTGGGCTCGGCTCAGGGCACTGGGCCCGTCTGTCGCGCCCATGTCAACTGCGCCGCCGGCTTTGTC
CTTGCCAACCGCGCCATGATTGTCATTGGCACCGACTATGGCATTTTTGTCTCGGACACGAATGAGCCGCGGGCC
TGGCGTCGGGTAAGGGCCCTTCTTGTACCCCTCTCTCTCTCTCTTGTCCTCTTTTTTCCCCTCTCTCTCTCTCTC
TCTCTTGTCCTCTTTGCTAACAACAAGCCCCCCCCCCCCCCTTGCACTACTAGACGGTCCAGGTCTACAAGGTGA
CGCAAATCGCCGTCCTCGAAGACTTCTCCCTCTGCCTCGTCATTGCCGACAAGTCGCTCGTCTCCTTTCCCCTCG
ATGTCGTCGCCCCCACTTCCGACTTTGCTCGGCCCCTCAACGACAACCCTCGCAACGCCCCCCAGCGCCTGGCCA
AGGACGTCAGCTACTTTGCCACAGCCCGCATGAAGGGCCGCATGCTCGTCTTCTACAAGCGCAAGGAGGGCTTGC
ACACCTCGTTCAAGGTGCTCGAGCCCGTCGTCCACAAGGCCACCGAGAAGCGCCTGCGTCTCTTTGGCGGCCGCA
AAGGCGCCGTCATCAGCGGAGGCCACACCGAGTCCTTTCGCGACTTTGACGAGTTCTACCTGCCCACCGAGTGCT
ACTCGCTCAGCCTCTTCCACACCTACATTGCTGTCGCCACCGCAAAGGGCATCGAGATGCTGACCCTCGACAAGA
AGCAGCCCATGTCCATCCCCGACCTCAAGGCCCCCGGCACCGTCAACATTGCTGGCCGCATCCGCGATCAGCGGC
CCCTTGGCATGTTTCGTCTCAACGACAGCGAGTTTATCCTCACCTACGAGGACTGTGCCGTCTATGTCGACAAGC
ACGGCGACGTCAGCCGCACCCTCATCATGGAGTACACGGGCAAGCAGAAAAAGGCTCGCGGCGCCACCATGTACG
GCCAGTATCTGCTGCTCTTCAACGACGACTATGTCGAGGTGCGCAACGCCGACAATGGCCGCCTGCGCCAAATCA
TTGCTGGCCGCGACGTACGCGTCATTGACTATGGCATGAGGGGCCCTACCGGCTCCTCTACCGCTCCCCTCATGA
CCCCCACCAACGGCAAAAGACCCAGCCAAATCTCCAAGGGCACCGTCAAAATCGCCATGAGCCACCCCGAGCTGC
CGGGCAGGCAGATTATCCTTGAGATGCTTCTCAACGACGGCCTTGCCGAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail