Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3104
Gene name
LocationContig_20:146343..147049
Strand+
Gene length (bp)706
Transcript length (bp)492
Coding sequence length (bp)492
Protein length (aa) 164

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03650 MPC Mitochondrial pyruvate carriers 1.6E-47 49 155

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P53311|MPC3_YEAST Mitochondrial pyruvate carrier 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPC3 PE=1 SV=1 49 153 5.0E-35
sp|P38857|MPC2_YEAST Mitochondrial pyruvate carrier 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPC2 PE=1 SV=1 49 162 1.0E-33
sp|Q09896|MPC2_SCHPO Probable mitochondrial pyruvate carrier 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mpc2 PE=3 SV=1 49 154 2.0E-33
sp|O01578|MPC2_CAEEL Probable mitochondrial pyruvate carrier 2 OS=Caenorhabditis elegans GN=F53F10.3 PE=3 SV=2 53 138 4.0E-28
sp|O49636|MPC4_ARATH Mitochondrial pyruvate carrier 4 OS=Arabidopsis thaliana GN=MPC4 PE=3 SV=1 50 134 7.0E-27
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P53311|MPC3_YEAST Mitochondrial pyruvate carrier 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPC3 PE=1 SV=1 49 153 5.0E-35
sp|P38857|MPC2_YEAST Mitochondrial pyruvate carrier 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPC2 PE=1 SV=1 49 162 1.0E-33
sp|Q09896|MPC2_SCHPO Probable mitochondrial pyruvate carrier 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mpc2 PE=3 SV=1 49 154 2.0E-33
sp|O01578|MPC2_CAEEL Probable mitochondrial pyruvate carrier 2 OS=Caenorhabditis elegans GN=F53F10.3 PE=3 SV=2 53 138 4.0E-28
sp|O49636|MPC4_ARATH Mitochondrial pyruvate carrier 4 OS=Arabidopsis thaliana GN=MPC4 PE=3 SV=1 50 134 7.0E-27
sp|O95563|MPC2_HUMAN Mitochondrial pyruvate carrier 2 OS=Homo sapiens GN=MPC2 PE=1 SV=1 50 143 8.0E-27
sp|P38718|MPC2_RAT Mitochondrial pyruvate carrier 2 OS=Rattus norvegicus GN=Mpc2 PE=2 SV=1 53 143 9.0E-26
sp|Q9D023|MPC2_MOUSE Mitochondrial pyruvate carrier 2 OS=Mus musculus GN=Mpc2 PE=1 SV=1 53 143 1.0E-25
sp|Q5R4Z3|MPC2_PONAB Mitochondrial pyruvate carrier 2 OS=Pongo abelii GN=MPC2 PE=2 SV=1 50 143 4.0E-25
sp|Q8L7H8|MPC2_ARATH Mitochondrial pyruvate carrier 2 OS=Arabidopsis thaliana GN=MPC2 PE=3 SV=1 50 134 4.0E-24
sp|Q8LD38|MPC3_ARATH Mitochondrial pyruvate carrier 3 OS=Arabidopsis thaliana GN=MPC3 PE=2 SV=1 50 134 1.0E-22
sp|Q949R9|MPC1_ARATH Mitochondrial pyruvate carrier 1 OS=Arabidopsis thaliana GN=MPC1 PE=3 SV=1 49 144 3.0E-12
sp|P63031|MPC1_RAT Mitochondrial pyruvate carrier 1 OS=Rattus norvegicus GN=Mpc1 PE=3 SV=1 61 145 3.0E-10
sp|P63030|MPC1_MOUSE Mitochondrial pyruvate carrier 1 OS=Mus musculus GN=Mpc1 PE=1 SV=1 61 145 3.0E-10
sp|Q3ZCG2|MPC1_BOVIN Mitochondrial pyruvate carrier 1 OS=Bos taurus GN=MPC1 PE=1 SV=1 61 145 1.0E-09
sp|Q9Y5U8|MPC1_HUMAN Mitochondrial pyruvate carrier 1 OS=Homo sapiens GN=MPC1 PE=1 SV=1 61 145 1.0E-08
sp|Q7KSC4|MPC1_DROME Mitochondrial pyruvate carrier 1 OS=Drosophila melanogaster GN=Mpc1 PE=3 SV=1 61 121 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006850 mitochondrial pyruvate transmembrane transport Yes
GO:0005743 mitochondrial inner membrane Yes
GO:0110165 cellular anatomical entity No
GO:0006811 ion transport No
GO:0005575 cellular_component No
GO:0008150 biological_process No
GO:0016020 membrane No
GO:0071702 organic substance transport No
GO:0015718 monocarboxylic acid transport No
GO:0046942 carboxylic acid transport No
GO:1903825 organic acid transmembrane transport No
GO:0006820 anion transport No
GO:0051179 localization No
GO:1905039 carboxylic acid transmembrane transport No
GO:0015711 organic anion transport No
GO:0031966 mitochondrial membrane No
GO:0015849 organic acid transport No
GO:0006810 transport No
GO:1901475 pyruvate transmembrane transport No
GO:0055085 transmembrane transport No
GO:0009987 cellular process No
GO:0019866 organelle inner membrane No
GO:0006848 pyruvate transport No
GO:1990542 mitochondrial transmembrane transport No
GO:0098656 anion transmembrane transport No
GO:0034220 ion transmembrane transport No
GO:0031090 organelle membrane No
GO:0051234 establishment of localization No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 115 137 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5683
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|3104 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|00827
Ophiocordyceps camponoti-rufipedis Ophun1|5527
Ophiocordyceps kimflemingae Ophio5|4729
Ophiocordyceps subramaniannii Hirsu2|8491

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3104
MSLAASLSRAAVRRGPWQSFARPRLGPFGAHGRRWQSGASGGTASQSWYRRIWESEVGVKTVHFWAPVMKWALVV
AGISDFARPAEKLSFTQNLALTCTGLIWTRWCLIIKPKNYLLAAVNFFLGLVGITQLTRIGIYESSKKKSVADLV
QDVKQDIKENVKP*
Coding >OphauB2|3104
ATGTCCCTCGCAGCATCTCTCTCTCGCGCTGCCGTGCGCCGCGGCCCCTGGCAGTCTTTTGCGCGCCCTCGCCTT
GGTCCGTTTGGCGCACACGGCCGCCGATGGCAGAGCGGCGCCTCTGGCGGCACGGCGTCACAGAGCTGGTACCGA
CGCATATGGGAGAGCGAGGTTGGAGTCAAGACGGTTCATTTCTGGGCTCCCGTCATGAAGTGGGCGCTTGTCGTT
GCTGGCATATCCGACTTTGCCCGCCCTGCCGAAAAACTCTCCTTTACGCAAAACCTGGCGCTGACTTGCACCGGC
CTCATCTGGACTCGCTGGTGTCTTATAATCAAGCCCAAGAATTACCTCCTCGCCGCCGTCAACTTCTTCCTCGGC
CTTGTCGGCATTACCCAGCTCACCCGAATCGGCATTTACGAGTCTTCAAAGAAGAAGTCGGTTGCCGACCTTGTC
CAAGATGTCAAGCAGGACATCAAGGAGAATGTCAAGCCTTAG
Transcript >OphauB2|3104
ATGTCCCTCGCAGCATCTCTCTCTCGCGCTGCCGTGCGCCGCGGCCCCTGGCAGTCTTTTGCGCGCCCTCGCCTT
GGTCCGTTTGGCGCACACGGCCGCCGATGGCAGAGCGGCGCCTCTGGCGGCACGGCGTCACAGAGCTGGTACCGA
CGCATATGGGAGAGCGAGGTTGGAGTCAAGACGGTTCATTTCTGGGCTCCCGTCATGAAGTGGGCGCTTGTCGTT
GCTGGCATATCCGACTTTGCCCGCCCTGCCGAAAAACTCTCCTTTACGCAAAACCTGGCGCTGACTTGCACCGGC
CTCATCTGGACTCGCTGGTGTCTTATAATCAAGCCCAAGAATTACCTCCTCGCCGCCGTCAACTTCTTCCTCGGC
CTTGTCGGCATTACCCAGCTCACCCGAATCGGCATTTACGAGTCTTCAAAGAAGAAGTCGGTTGCCGACCTTGTC
CAAGATGTCAAGCAGGACATCAAGGAGAATGTCAAGCCTTAG
Gene >OphauB2|3104
ATGTCCCTCGCAGCATCTCTCTCTCGCGCTGCCGTGCGCCGCGGCCCCTGGCAGTCTTTTGCGCGCCCTCGCCTT
GGTCCGTTTGGCGCACACGGCCGCCGATGGCAGAGCGGCGCCTCTGGCGGCACGGCGTCACAGAGCTGGTACCGA
CGCATATGGGAGAGCGAGGTTGGAGTCAAGACGGTTCATTTCTGGTGCGTTGCCAGTTTTTCTTGTTGCTGGCCT
TGACTAACAAGAGTCTTGTTGTCCAGGGCTCCCGTCATGAAGGTGCGATGCCAGTCTTTGTCCAAGAAGAAATCA
ATGGCAAAGAGGAGAGATGCAAGCAAACAAACAAGAGACGCGGCTGACAGGAGCAAGCACTAGTGGGCGCTTGTC
GTTGCTGGCATATCCGACTTTGCCCGCCCTGCCGAAAAACTCTCCTTTACGCAAAACCTGGCGCTGACTTGCACC
GGCCTCATCTGGACTCGCTGGTGTCTTATAATCAAGCCCAAGAATTACCTGTACGCTCCCGTCTTGCGCCTGGCC
GTCCCTGTTCCTTGCTGACACGCGTCGTCTGTCCAGCCTCGCCGCCGTCAACTTCTTCCTCGGCCTTGTCGGCAT
TACCCAGCTCACCCGAATCGGCATTTACGAGTCTTCAAAGAAGAAGTCGGTTGCCGACCTTGTCCAAGATGTCAA
GCAGGACATCAAGGAGAATGTCAAGCCTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail