Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3089
Gene name
LocationContig_20:116094..117631
Strand-
Gene length (bp)1537
Transcript length (bp)1470
Coding sequence length (bp)1470
Protein length (aa) 490

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06432 GPI2 Phosphatidylinositol N-acetylglucosaminyltransferase 2.2E-137 82 474

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59802|GPI2_SCHPO Phosphatidylinositol N-acetylglucosaminyltransferase GPI2 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpi2 PE=3 SV=1 278 478 2.0E-36
sp|Q54M40|PIGC_DICDI Putative phosphatidylinositol N-acetylglucosaminyltransferase subunit C OS=Dictyostelium discoideum GN=pigC PE=3 SV=1 281 479 2.0E-31
sp|Q92535|PIGC_HUMAN Phosphatidylinositol N-acetylglucosaminyltransferase subunit C OS=Homo sapiens GN=PIGC PE=2 SV=1 290 477 4.0E-23
sp|Q5PQQ4|PIGC_RAT Phosphatidylinositol N-acetylglucosaminyltransferase subunit C OS=Rattus norvegicus GN=Pigc PE=2 SV=1 292 477 6.0E-23
sp|Q3ZBX1|PIGC_BOVIN Phosphatidylinositol N-acetylglucosaminyltransferase subunit C OS=Bos taurus GN=PIGC PE=2 SV=1 296 477 1.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59802|GPI2_SCHPO Phosphatidylinositol N-acetylglucosaminyltransferase GPI2 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpi2 PE=3 SV=1 278 478 2.0E-36
sp|Q54M40|PIGC_DICDI Putative phosphatidylinositol N-acetylglucosaminyltransferase subunit C OS=Dictyostelium discoideum GN=pigC PE=3 SV=1 281 479 2.0E-31
sp|Q92535|PIGC_HUMAN Phosphatidylinositol N-acetylglucosaminyltransferase subunit C OS=Homo sapiens GN=PIGC PE=2 SV=1 290 477 4.0E-23
sp|Q5PQQ4|PIGC_RAT Phosphatidylinositol N-acetylglucosaminyltransferase subunit C OS=Rattus norvegicus GN=Pigc PE=2 SV=1 292 477 6.0E-23
sp|Q3ZBX1|PIGC_BOVIN Phosphatidylinositol N-acetylglucosaminyltransferase subunit C OS=Bos taurus GN=PIGC PE=2 SV=1 296 477 1.0E-22
sp|Q9CXR4|PIGC_MOUSE Phosphatidylinositol N-acetylglucosaminyltransferase subunit C OS=Mus musculus GN=Pigc PE=2 SV=1 292 477 2.0E-22
sp|O59802|GPI2_SCHPO Phosphatidylinositol N-acetylglucosaminyltransferase GPI2 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gpi2 PE=3 SV=1 79 170 5.0E-15
sp|P46961|GPI2_YEAST Phosphatidylinositol N-acetylglucosaminyltransferase GPI2 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPI2 PE=1 SV=2 296 480 4.0E-14
sp|Q5PQQ4|PIGC_RAT Phosphatidylinositol N-acetylglucosaminyltransferase subunit C OS=Rattus norvegicus GN=Pigc PE=2 SV=1 82 139 4.0E-10
sp|Q9CXR4|PIGC_MOUSE Phosphatidylinositol N-acetylglucosaminyltransferase subunit C OS=Mus musculus GN=Pigc PE=2 SV=1 82 139 4.0E-10
sp|Q92535|PIGC_HUMAN Phosphatidylinositol N-acetylglucosaminyltransferase subunit C OS=Homo sapiens GN=PIGC PE=2 SV=1 82 170 9.0E-10
sp|Q3ZBX1|PIGC_BOVIN Phosphatidylinositol N-acetylglucosaminyltransferase subunit C OS=Bos taurus GN=PIGC PE=2 SV=1 82 139 1.0E-09
sp|Q54M40|PIGC_DICDI Putative phosphatidylinositol N-acetylglucosaminyltransferase subunit C OS=Dictyostelium discoideum GN=pigC PE=3 SV=1 82 141 9.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0006506 GPI anchor biosynthetic process Yes
GO:0016021 integral component of membrane Yes
GO:0036211 protein modification process No
GO:0045017 glycerolipid biosynthetic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:1901137 carbohydrate derivative biosynthetic process No
GO:1903509 liposaccharide metabolic process No
GO:0006644 phospholipid metabolic process No
GO:0006664 glycolipid metabolic process No
GO:0031224 intrinsic component of membrane No
GO:0006497 protein lipidation No
GO:0046474 glycerophospholipid biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0006793 phosphorus metabolic process No
GO:0046467 membrane lipid biosynthetic process No
GO:0090407 organophosphate biosynthetic process No
GO:0006661 phosphatidylinositol biosynthetic process No
GO:0044255 cellular lipid metabolic process No
GO:0008150 biological_process No
GO:0008610 lipid biosynthetic process No
GO:0005575 cellular_component No
GO:0043170 macromolecule metabolic process No
GO:0006650 glycerophospholipid metabolic process No
GO:0043412 macromolecule modification No
GO:0006629 lipid metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0019538 protein metabolic process No
GO:0006643 membrane lipid metabolic process No
GO:0009058 biosynthetic process No
GO:0046486 glycerolipid metabolic process No
GO:0044238 primary metabolic process No
GO:0009987 cellular process No
GO:0008654 phospholipid biosynthetic process No
GO:0008152 metabolic process No
GO:0009247 glycolipid biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0006505 GPI anchor metabolic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:0046488 phosphatidylinositol metabolic process No
GO:0019637 organophosphate metabolic process No
GO:0110165 cellular anatomical entity No
GO:0006807 nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 126 145 19
2 324 346 22
3 376 393 17
4 406 423 17
5 438 460 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3089
MPSPTDDEAASIQPLSRTSTLNSSGRSHLSPQDAAISPPLRARAPGLGALGIRDSDGAATLAHMGHMGSERSRSR
HRHKRTWKKLMWVKQSYPDNYTDQATFLEHLQRNPRLKPYDFWPLVADSTVILQHVCSIILFIVCFVGIFQERVS
PVSVVSWSSFATFIGWILWERWVSEEEDQDDDPIAGATTVVRAGSVRRRARAGSIRRPPLSTRPESKAPAPCPAS
TSRPTLDGASASLAADMDGTSKPQLSALLSSSQPSKNGIGDIPRMSQDTIPEDGPLVPPEANRTHQRLETIKSAL
LIYCTLLGLSPILKSLTRSTSSDSIWAMSFWLLAINVFFFDYSGGVGVKFPASLSTNAALMASTVLASRLPSTKQ
VFSLTLFSIEVFGLFPVFRRHVKHRSWRYHSVLTGILVLGAGWGMGIVLGDAKAGTWPWKSGIVGMVVGVLASAL
ASGGCSWWLIGLQKYKNEIRGPWDPARPIIMSRTRWNDR*
Coding >OphauB2|3089
ATGCCCTCGCCAACCGACGATGAAGCTGCATCCATCCAGCCTCTAAGTCGCACCTCGACCCTCAATTCCTCTGGA
CGTTCCCATCTGTCGCCTCAAGATGCCGCCATCTCTCCACCGCTGCGGGCGCGCGCTCCCGGCCTTGGTGCTCTT
GGAATTCGCGACTCGGATGGCGCTGCCACTCTTGCCCACATGGGTCACATGGGCAGCGAACGCAGTAGAAGTCGC
CATAGGCATAAGCGCACCTGGAAGAAGCTCATGTGGGTAAAGCAGTCATACCCGGACAACTACACCGATCAAGCC
ACCTTTCTGGAGCATCTTCAGCGCAACCCGCGTCTTAAGCCATATGATTTTTGGCCGCTTGTTGCCGACTCGACG
GTGATCCTTCAACACGTCTGCTCCATCATCCTCTTCATTGTCTGTTTTGTCGGCATATTCCAGGAGCGCGTCTCC
CCAGTATCCGTTGTCAGCTGGAGCAGCTTTGCCACGTTTATCGGCTGGATTCTTTGGGAGCGATGGGTGTCAGAA
GAAGAGGACCAGGACGACGATCCCATCGCTGGGGCGACCACGGTGGTGCGTGCTGGAAGCGTCCGCCGCCGAGCC
CGCGCCGGAAGCATCCGTCGTCCTCCGCTCAGCACGAGGCCCGAGTCCAAGGCGCCGGCGCCATGCCCAGCCTCA
ACGTCGCGGCCCACACTCGACGGGGCGAGTGCCAGTCTGGCCGCCGACATGGATGGGACATCAAAGCCGCAGCTT
TCGGCCCTGCTTAGCTCGTCACAGCCCTCAAAGAATGGAATTGGAGACATTCCGCGCATGTCTCAGGATACGATA
CCAGAGGATGGTCCCTTGGTTCCCCCCGAGGCCAATCGCACTCATCAGCGGCTCGAGACCATCAAGTCAGCGCTG
CTCATCTATTGCACCTTGCTGGGTCTCAGCCCCATTCTCAAGTCGCTCACACGATCAACGTCCAGCGACAGCATC
TGGGCCATGTCCTTCTGGCTCCTTGCCATCAATGTCTTCTTCTTTGATTACTCTGGCGGCGTGGGCGTCAAATTC
CCAGCCTCGCTTTCTACCAATGCTGCCTTGATGGCGTCGACAGTGCTGGCAAGCCGGCTGCCCTCAACTAAGCAG
GTGTTTAGCCTGACGCTCTTCAGCATTGAAGTATTTGGCCTTTTTCCAGTATTCCGTCGCCACGTCAAACATCGG
AGCTGGAGATACCACAGTGTGCTAACTGGCATACTCGTTTTGGGAGCGGGCTGGGGCATGGGAATAGTGCTCGGA
GATGCCAAGGCCGGCACGTGGCCGTGGAAGAGCGGCATTGTTGGCATGGTGGTTGGCGTCTTGGCGTCGGCACTG
GCGTCGGGCGGTTGCAGCTGGTGGCTTATTGGATTGCAAAAGTACAAGAACGAGATTCGAGGGCCATGGGACCCA
GCCAGACCCATCATCATGAGCAGGACACGCTGGAATGACAGATGA
Transcript >OphauB2|3089
ATGCCCTCGCCAACCGACGATGAAGCTGCATCCATCCAGCCTCTAAGTCGCACCTCGACCCTCAATTCCTCTGGA
CGTTCCCATCTGTCGCCTCAAGATGCCGCCATCTCTCCACCGCTGCGGGCGCGCGCTCCCGGCCTTGGTGCTCTT
GGAATTCGCGACTCGGATGGCGCTGCCACTCTTGCCCACATGGGTCACATGGGCAGCGAACGCAGTAGAAGTCGC
CATAGGCATAAGCGCACCTGGAAGAAGCTCATGTGGGTAAAGCAGTCATACCCGGACAACTACACCGATCAAGCC
ACCTTTCTGGAGCATCTTCAGCGCAACCCGCGTCTTAAGCCATATGATTTTTGGCCGCTTGTTGCCGACTCGACG
GTGATCCTTCAACACGTCTGCTCCATCATCCTCTTCATTGTCTGTTTTGTCGGCATATTCCAGGAGCGCGTCTCC
CCAGTATCCGTTGTCAGCTGGAGCAGCTTTGCCACGTTTATCGGCTGGATTCTTTGGGAGCGATGGGTGTCAGAA
GAAGAGGACCAGGACGACGATCCCATCGCTGGGGCGACCACGGTGGTGCGTGCTGGAAGCGTCCGCCGCCGAGCC
CGCGCCGGAAGCATCCGTCGTCCTCCGCTCAGCACGAGGCCCGAGTCCAAGGCGCCGGCGCCATGCCCAGCCTCA
ACGTCGCGGCCCACACTCGACGGGGCGAGTGCCAGTCTGGCCGCCGACATGGATGGGACATCAAAGCCGCAGCTT
TCGGCCCTGCTTAGCTCGTCACAGCCCTCAAAGAATGGAATTGGAGACATTCCGCGCATGTCTCAGGATACGATA
CCAGAGGATGGTCCCTTGGTTCCCCCCGAGGCCAATCGCACTCATCAGCGGCTCGAGACCATCAAGTCAGCGCTG
CTCATCTATTGCACCTTGCTGGGTCTCAGCCCCATTCTCAAGTCGCTCACACGATCAACGTCCAGCGACAGCATC
TGGGCCATGTCCTTCTGGCTCCTTGCCATCAATGTCTTCTTCTTTGATTACTCTGGCGGCGTGGGCGTCAAATTC
CCAGCCTCGCTTTCTACCAATGCTGCCTTGATGGCGTCGACAGTGCTGGCAAGCCGGCTGCCCTCAACTAAGCAG
GTGTTTAGCCTGACGCTCTTCAGCATTGAAGTATTTGGCCTTTTTCCAGTATTCCGTCGCCACGTCAAACATCGG
AGCTGGAGATACCACAGTGTGCTAACTGGCATACTCGTTTTGGGAGCGGGCTGGGGCATGGGAATAGTGCTCGGA
GATGCCAAGGCCGGCACGTGGCCGTGGAAGAGCGGCATTGTTGGCATGGTGGTTGGCGTCTTGGCGTCGGCACTG
GCGTCGGGCGGTTGCAGCTGGTGGCTTATTGGATTGCAAAAGTACAAGAACGAGATTCGAGGGCCATGGGACCCA
GCCAGACCCATCATCATGAGCAGGACACGCTGGAATGACAGATGA
Gene >OphauB2|3089
ATGCCCTCGCCAACCGACGATGAAGCTGCATCCATCCAGCCTCTAAGTCGCACCTCGACCCTCAATTCCTCTGGA
CGTTCCCATCTGTCGCCTCAAGATGCCGCCATCTCTCCACCGCTGCGGGCGCGCGCTCCCGGCCTTGGTGCTCTT
GGAATTCGCGACTCGGATGGCGCTGCCACTCTTGCCCACATGGGTCACATGGGCAGCGAACGCAGTAGAAGTCGC
CATAGGCATAAGCGCACCTGGAAGAAGCTCATGTGGGTAAAGCAGTCATGTATGTGGGCCAGCATTCTCCCCTCC
CCCCCCTTTCAAGAGGACAGACAGCTTATTGTTTGCTACAGACCCGGACAACTACACCGATCAAGCCACCTTTCT
GGAGCATCTTCAGCGCAACCCGCGTCTTAAGCCATATGATTTTTGGCCGCTTGTTGCCGACTCGACGGTGATCCT
TCAACACGTCTGCTCCATCATCCTCTTCATTGTCTGTTTTGTCGGCATATTCCAGGAGCGCGTCTCCCCAGTATC
CGTTGTCAGCTGGAGCAGCTTTGCCACGTTTATCGGCTGGATTCTTTGGGAGCGATGGGTGTCAGAAGAAGAGGA
CCAGGACGACGATCCCATCGCTGGGGCGACCACGGTGGTGCGTGCTGGAAGCGTCCGCCGCCGAGCCCGCGCCGG
AAGCATCCGTCGTCCTCCGCTCAGCACGAGGCCCGAGTCCAAGGCGCCGGCGCCATGCCCAGCCTCAACGTCGCG
GCCCACACTCGACGGGGCGAGTGCCAGTCTGGCCGCCGACATGGATGGGACATCAAAGCCGCAGCTTTCGGCCCT
GCTTAGCTCGTCACAGCCCTCAAAGAATGGAATTGGAGACATTCCGCGCATGTCTCAGGATACGATACCAGAGGA
TGGTCCCTTGGTTCCCCCCGAGGCCAATCGCACTCATCAGCGGCTCGAGACCATCAAGTCAGCGCTGCTCATCTA
TTGCACCTTGCTGGGTCTCAGCCCCATTCTCAAGTCGCTCACACGATCAACGTCCAGCGACAGCATCTGGGCCAT
GTCCTTCTGGCTCCTTGCCATCAATGTCTTCTTCTTTGATTACTCTGGCGGCGTGGGCGTCAAATTCCCAGCCTC
GCTTTCTACCAATGCTGCCTTGATGGCGTCGACAGTGCTGGCAAGCCGGCTGCCCTCAACTAAGCAGGTGTTTAG
CCTGACGCTCTTCAGCATTGAAGTATTTGGCCTTTTTCCAGTATTCCGTCGCCACGTCAAACATCGGAGCTGGAG
ATACCACAGTGTGCTAACTGGCATACTCGTTTTGGGAGCGGGCTGGGGCATGGGAATAGTGCTCGGAGATGCCAA
GGCCGGCACGTGGCCGTGGAAGAGCGGCATTGTTGGCATGGTGGTTGGCGTCTTGGCGTCGGCACTGGCGTCGGG
CGGTTGCAGCTGGTGGCTTATTGGATTGCAAAAGTACAAGAACGAGATTCGAGGGCCATGGGACCCAGCCAGACC
CATCATCATGAGCAGGACACGCTGGAATGACAGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail