Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3082
Gene name
LocationContig_20:99006..100836
Strand-
Gene length (bp)1830
Transcript length (bp)1650
Coding sequence length (bp)1650
Protein length (aa) 550

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00349 Hexokinase_1 Hexokinase 8.5E-77 8 219
PF03727 Hexokinase_2 Hexokinase 2.4E-74 229 490

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q92407|HXKG_ASPNG Glucokinase OS=Aspergillus niger GN=glkA PE=1 SV=1 2 495 0.0E+00
sp|P17709|HXKG_YEAST Glucokinase-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GLK1 PE=1 SV=1 9 491 6.0E-106
sp|Q04409|EMI2_YEAST Putative glucokinase-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EMI2 PE=1 SV=1 2 491 4.0E-105
sp|Q6CUZ3|HXKG_KLULA Glucokinase-1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GLK1 PE=1 SV=1 10 491 4.0E-101
sp|P50521|HXK2_SCHPO Hexokinase-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hxk2 PE=2 SV=1 9 496 1.0E-98
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q92407|HXKG_ASPNG Glucokinase OS=Aspergillus niger GN=glkA PE=1 SV=1 2 495 0.0E+00
sp|P17709|HXKG_YEAST Glucokinase-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GLK1 PE=1 SV=1 9 491 6.0E-106
sp|Q04409|EMI2_YEAST Putative glucokinase-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EMI2 PE=1 SV=1 2 491 4.0E-105
sp|Q6CUZ3|HXKG_KLULA Glucokinase-1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GLK1 PE=1 SV=1 10 491 4.0E-101
sp|P50521|HXK2_SCHPO Hexokinase-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hxk2 PE=2 SV=1 9 496 1.0E-98
sp|Q1WM16|HXK7_ORYSJ Hexokinase-7 OS=Oryza sativa subsp. japonica GN=HXK7 PE=2 SV=2 37 480 1.0E-81
sp|Q9SEK3|HXK1_SPIOL Hexokinase-1 OS=Spinacia oleracea GN=HXK1 PE=2 SV=1 31 488 1.0E-79
sp|Q8LQ68|HXK6_ORYSJ Hexokinase-6 OS=Oryza sativa subsp. japonica GN=HXK6 PE=2 SV=1 28 488 3.0E-79
sp|Q42525|HXK1_ARATH Hexokinase-1 OS=Arabidopsis thaliana GN=HXK1 PE=1 SV=2 31 488 4.0E-78
sp|P33284|HXK_KLULA Hexokinase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RAG5 PE=1 SV=3 14 493 1.0E-77
sp|P80581|HXK_EMENI Hexokinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=hxkA PE=1 SV=2 14 499 5.0E-76
sp|Q1WM15|HXK8_ORYSJ Hexokinase-8 OS=Oryza sativa subsp. japonica GN=HXK8 PE=2 SV=2 36 493 9.0E-76
sp|P93834|HXK2_ARATH Hexokinase-2 OS=Arabidopsis thaliana GN=HXK2 PE=1 SV=1 31 488 9.0E-76
sp|Q2KNB7|HXK9_ORYSJ Hexokinase-9 OS=Oryza sativa subsp. japonica GN=HXK9 PE=2 SV=1 27 488 5.0E-75
sp|Q9SQ76|HXK2_SOLTU Hexokinase-2 OS=Solanum tuberosum GN=HXK2 PE=2 SV=1 31 488 5.0E-75
sp|Q09756|HXK1_SCHPO Hexokinase-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hxk1 PE=2 SV=1 3 507 8.0E-75
sp|P04807|HXKB_YEAST Hexokinase-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXK2 PE=1 SV=4 25 462 2.0E-74
sp|P04806|HXKA_YEAST Hexokinase-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXK1 PE=1 SV=2 3 493 5.0E-74
sp|Q9SEK2|HXK1_TOBAC Hexokinase-1 OS=Nicotiana tabacum GN=HXK1 PE=2 SV=1 31 488 5.0E-74
sp|P83776|HXKB_CANAL Hexokinase-2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HXK2 PE=1 SV=2 10 498 1.0E-73
sp|Q2KNB9|HXK2_ORYSJ Hexokinase-2 OS=Oryza sativa subsp. japonica GN=HXK2 PE=2 SV=1 31 483 1.0E-73
sp|P50506|HXK_SCHOC Hexokinase OS=Schwanniomyces occidentalis GN=HXK PE=3 SV=1 3 451 1.0E-69
sp|Q5W676|HXK5_ORYSJ Hexokinase-5 OS=Oryza sativa subsp. japonica GN=HXK5 PE=2 SV=1 28 488 2.0E-69
sp|Q6Q8A5|HXK2_TOBAC Hexokinase-2, chloroplastic OS=Nicotiana tabacum GN=HXK2 PE=2 SV=1 21 483 3.0E-68
sp|Q6Z398|HXK4_ORYSJ Hexokinase-4, chloroplastic OS=Oryza sativa subsp. japonica GN=HXK4 PE=2 SV=1 32 483 9.0E-67
sp|Q9NFT7|HXK2_DROME Hexokinase type 2 OS=Drosophila melanogaster GN=Hex-t2 PE=2 SV=4 6 491 5.0E-65
sp|Q91W97|HKDC1_MOUSE Putative hexokinase HKDC1 OS=Mus musculus GN=Hkdc1 PE=2 SV=1 25 508 4.0E-64
sp|Q2KNB4|HXK3_ORYSJ Hexokinase-3 OS=Oryza sativa subsp. japonica GN=HXK3 PE=2 SV=1 31 498 4.0E-64
sp|Q9FZG4|HXKL1_ARATH Hexokinase-like 1 protein OS=Arabidopsis thaliana GN=At1g47840 PE=2 SV=2 28 488 2.0E-63
sp|Q2TB90|HKDC1_HUMAN Putative hexokinase HKDC1 OS=Homo sapiens GN=HKDC1 PE=1 SV=3 9 496 2.0E-63
sp|Q9LPS1|HXK3_ARATH Hexokinase-3 OS=Arabidopsis thaliana GN=At1g50460 PE=1 SV=1 31 492 1.0E-61
sp|Q26609|HXK_SCHMA Hexokinase OS=Schistosoma mansoni PE=1 SV=2 3 493 2.0E-61
sp|P52790|HXK3_HUMAN Hexokinase-3 OS=Homo sapiens GN=HK3 PE=1 SV=2 30 496 9.0E-61
sp|Q3TRM8|HXK3_MOUSE Hexokinase-3 OS=Mus musculus GN=Hk3 PE=1 SV=2 32 496 3.0E-60
sp|P27926|HXK3_RAT Hexokinase-3 OS=Rattus norvegicus GN=Hk3 PE=2 SV=1 21 496 3.0E-60
sp|P17710|HXK1_MOUSE Hexokinase-1 OS=Mus musculus GN=Hk1 PE=1 SV=3 11 494 2.0E-59
sp|O64390|HXK1_SOLTU Hexokinase-1 OS=Solanum tuberosum GN=HXK1 PE=1 SV=1 31 487 7.0E-59
sp|P27881|HXK2_RAT Hexokinase-2 OS=Rattus norvegicus GN=Hk2 PE=1 SV=1 31 498 2.0E-58
sp|O08528|HXK2_MOUSE Hexokinase-2 OS=Mus musculus GN=Hk2 PE=1 SV=1 31 498 3.0E-58
sp|Q5RC71|HXK1_PONAB Hexokinase-1 OS=Pongo abelii GN=HK1 PE=2 SV=1 20 494 7.0E-58
sp|P05708|HXK1_RAT Hexokinase-1 OS=Rattus norvegicus GN=Hk1 PE=1 SV=4 24 494 8.0E-58
sp|P19367|HXK1_HUMAN Hexokinase-1 OS=Homo sapiens GN=HK1 PE=1 SV=3 20 494 1.0E-57
sp|P52789|HXK2_HUMAN Hexokinase-2 OS=Homo sapiens GN=HK2 PE=1 SV=2 31 498 2.0E-57
sp|Q1W674|HXK2_PIG Hexokinase-2 OS=Sus scrofa GN=HK2 PE=2 SV=1 31 498 2.0E-56
sp|P27595|HXK1_BOVIN Hexokinase-1 OS=Bos taurus GN=HK1 PE=2 SV=1 24 494 5.0E-56
sp|A2PYL6|HXK2_HORSE Hexokinase-2 OS=Equus caballus GN=HK2 PE=2 SV=1 31 498 9.0E-56
sp|A2PYL8|HXK2_EQUGR Hexokinase-2 OS=Equus grevyi GN=HK2 PE=2 SV=1 31 498 9.0E-56
sp|A2PYL7|HXK2_EQUZE Hexokinase-2 OS=Equus zebra GN=HK2 PE=2 SV=1 31 498 9.0E-56
sp|P52789|HXK2_HUMAN Hexokinase-2 OS=Homo sapiens GN=HK2 PE=1 SV=2 1 521 5.0E-55
sp|P27881|HXK2_RAT Hexokinase-2 OS=Rattus norvegicus GN=Hk2 PE=1 SV=1 1 521 4.0E-54
sp|P35557|HXK4_HUMAN Glucokinase OS=Homo sapiens GN=GCK PE=1 SV=1 2 493 8.0E-54
sp|O08528|HXK2_MOUSE Hexokinase-2 OS=Mus musculus GN=Hk2 PE=1 SV=1 1 521 3.0E-53
sp|Q1W674|HXK2_PIG Hexokinase-2 OS=Sus scrofa GN=HK2 PE=2 SV=1 16 521 3.0E-53
sp|P52792|HXK4_MOUSE Glucokinase OS=Mus musculus GN=Gck PE=1 SV=1 5 493 4.0E-52
sp|P17712|HXK4_RAT Glucokinase OS=Rattus norvegicus GN=Gck PE=1 SV=2 5 493 2.0E-51
sp|Q56XE8|HXK4_ARATH Hexokinase-4 OS=Arabidopsis thaliana GN=At3g20040 PE=2 SV=2 31 495 7.0E-51
sp|A2PYL8|HXK2_EQUGR Hexokinase-2 OS=Equus grevyi GN=HK2 PE=2 SV=1 1 494 4.0E-50
sp|A2PYL6|HXK2_HORSE Hexokinase-2 OS=Equus caballus GN=HK2 PE=2 SV=1 1 494 4.0E-50
sp|A2PYL7|HXK2_EQUZE Hexokinase-2 OS=Equus zebra GN=HK2 PE=2 SV=1 1 494 4.0E-50
sp|P17710|HXK1_MOUSE Hexokinase-1 OS=Mus musculus GN=Hk1 PE=1 SV=3 28 515 2.0E-49
sp|Q5RC71|HXK1_PONAB Hexokinase-1 OS=Pongo abelii GN=HK1 PE=2 SV=1 28 513 6.0E-48
sp|Q8LH82|HXK1_ORYSJ Hexokinase-1 OS=Oryza sativa subsp. japonica GN=HXK1 PE=2 SV=1 41 480 8.0E-48
sp|P19367|HXK1_HUMAN Hexokinase-1 OS=Homo sapiens GN=HK1 PE=1 SV=3 28 513 1.0E-47
sp|Q02155|HXK_PLAFA Hexokinase OS=Plasmodium falciparum GN=HK PE=3 SV=1 9 490 1.0E-47
sp|Q2KNB5|HXK10_ORYSJ Hexokinase-10 OS=Oryza sativa subsp. japonica GN=HXK10 PE=2 SV=1 21 483 9.0E-47
sp|Q91W97|HKDC1_MOUSE Putative hexokinase HKDC1 OS=Mus musculus GN=Hkdc1 PE=2 SV=1 9 495 1.0E-46
sp|P05708|HXK1_RAT Hexokinase-1 OS=Rattus norvegicus GN=Hk1 PE=1 SV=4 28 494 6.0E-46
sp|P27926|HXK3_RAT Hexokinase-3 OS=Rattus norvegicus GN=Hk3 PE=2 SV=1 29 515 3.0E-45
sp|Q2TB90|HKDC1_HUMAN Putative hexokinase HKDC1 OS=Homo sapiens GN=HKDC1 PE=1 SV=3 9 521 1.0E-42
sp|Q3TRM8|HXK3_MOUSE Hexokinase-3 OS=Mus musculus GN=Hk3 PE=1 SV=2 29 517 3.0E-41
sp|Q9NFT9|HXK1_DROME Hexokinase type 1 OS=Drosophila melanogaster GN=Hex-t1 PE=2 SV=1 6 492 4.0E-41
sp|Q969A8|HXK_TOXGO Hexokinase OS=Toxoplasma gondii GN=HXK PE=2 SV=1 28 490 3.0E-38
sp|P52790|HXK3_HUMAN Hexokinase-3 OS=Homo sapiens GN=HK3 PE=1 SV=2 29 494 4.0E-38
sp|P27595|HXK1_BOVIN Hexokinase-1 OS=Bos taurus GN=HK1 PE=2 SV=1 1 494 6.0E-35
sp|Q4U3Y2|HXK1_ASPFU Hexokinase-1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=hxkA PE=2 SV=1 21 498 2.0E-33
sp|Q9T071|HXKL2_ARATH Probable hexokinase-like 2 protein OS=Arabidopsis thaliana GN=At4g37840 PE=3 SV=1 42 488 2.0E-31
sp|Q59RW5|HXK1_CANAL N-acetylglucosamine kinase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HXK1 PE=1 SV=1 17 486 1.0E-12
[Show less]

GO

GO Term Description Terminal node
GO:0016773 phosphotransferase activity, alcohol group as acceptor Yes
GO:0005524 ATP binding Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0017076 purine nucleotide binding No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0032553 ribonucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0043168 anion binding No
GO:0097159 organic cyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0071704 organic substance metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0008152 metabolic process No
GO:0044238 primary metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0016740 transferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 66 0.45

Transmembrane Domains

Domain # Start End Length
1 524 546 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3082
MALADETTRVVSNFDFSDSDVNRHVREFLRQMAEGLQKDGTSISQIPTYVTGVPNGTEKGLYLAVDLGGTNFRVC
SIMLNGDTTFNLTYNKVAIPKHLMVAKTARELFAFLAKQIELFLREHHAEHFESHTRRRNTSSTPLGYRDEHIFR
LGFTFSFPVRQLGINKGKLIRWTKGFDIPDAIGKDVCLLLQDEIDRLRLPVKVVALVNDTVGTLMARSYTSNGKH
RSVLGGIFGTGTNGAYIEKTANIKKPIEGEFDTSTGEMVVNMEWGSFDNQLNVLPSTPWDKSLDAESVNPGIHMF
EKRVSGMFLGEIVRRAVVDMMKNDAISLFKDVNSSFNDWGTTTNISPQSGMLKQWGLDSAILSVAASDNSPELST
LRQELENTLDIYNPSLEDAQAFKAVAGAVARRAARLSAVAIGAVALQSGKLDDPDEEVLDIGVDGSLVEHYPFFR
DMIYDALAVIEGIGPKGAEKIRIGIAKDGSGVGAALIALVAQRMEKPGDFLADLRKDIRRSLEAMPVPAEETHIP
RTAFMVAGAVGLVAIAAIWWSRHR*
Coding >OphauB2|3082
ATGGCTCTGGCTGATGAGACGACGCGCGTCGTGTCCAACTTTGACTTTTCTGACAGTGATGTCAATCGTCATGTT
CGCGAGTTTTTGCGTCAGATGGCCGAGGGCCTGCAAAAGGACGGCACAAGCATCAGTCAGATTCCCACATATGTG
ACGGGAGTTCCAAATGGAACGGAAAAGGGTCTGTATCTGGCTGTTGATCTCGGAGGTACCAATTTTCGAGTCTGC
TCAATCATGCTCAACGGAGACACCACCTTTAACCTCACCTACAACAAGGTCGCTATTCCTAAACATCTCATGGTG
GCCAAAACGGCTAGAGAGCTTTTTGCCTTTTTGGCCAAACAAATCGAGCTATTCCTCCGTGAGCACCATGCCGAG
CATTTCGAGAGCCATACGCGTCGTCGCAACACCAGCAGCACTCCGTTGGGCTATCGCGACGAGCACATCTTCCGT
CTTGGCTTTACCTTTAGCTTCCCCGTTCGACAGCTTGGCATCAACAAGGGCAAACTTATAAGGTGGACCAAGGGC
TTTGACATTCCTGACGCCATCGGGAAAGATGTGTGCCTTTTGCTGCAGGACGAAATTGATCGTTTGCGCCTTCCT
GTCAAGGTGGTGGCGCTCGTCAACGACACTGTAGGGACGCTGATGGCTCGGTCATACACATCAAACGGCAAGCAC
CGGTCTGTCCTGGGTGGCATCTTCGGCACTGGCACCAATGGCGCTTATATTGAGAAGACGGCCAACATTAAAAAG
CCAATAGAGGGCGAGTTCGACACGTCGACGGGAGAAATGGTTGTCAATATGGAATGGGGATCTTTTGACAACCAA
TTGAATGTACTGCCTTCGACTCCGTGGGACAAGTCACTAGATGCTGAAAGCGTAAACCCGGGCATTCACATGTTC
GAAAAGCGCGTCTCGGGCATGTTTTTGGGCGAAATAGTCCGCCGCGCCGTGGTGGACATGATGAAAAACGACGCT
ATCTCGCTCTTCAAGGACGTCAACTCGAGCTTCAACGACTGGGGCACCACGACAAACATCAGCCCTCAGTCAGGC
ATGCTGAAACAGTGGGGTCTGGACAGCGCCATCCTGTCGGTTGCTGCGTCGGACAACAGCCCGGAGCTGTCAACC
CTGCGTCAAGAATTGGAGAATACACTCGACATCTACAACCCTTCGCTTGAAGACGCACAGGCCTTCAAGGCAGTT
GCTGGCGCCGTGGCCCGTCGCGCAGCCAGGCTATCGGCTGTTGCCATTGGTGCCGTGGCTTTGCAGTCGGGCAAA
CTTGACGACCCAGACGAAGAAGTGCTCGATATTGGCGTTGATGGCAGTCTAGTAGAACACTATCCCTTCTTTAGA
GACATGATATACGATGCGCTGGCGGTTATCGAGGGCATTGGACCCAAGGGTGCTGAGAAGATACGTATTGGCATA
GCAAAGGACGGCAGTGGCGTTGGCGCTGCCTTGATTGCGCTCGTAGCGCAACGCATGGAGAAGCCTGGAGACTTT
TTGGCGGACCTGAGAAAGGACATTCGGCGAAGTCTCGAGGCCATGCCGGTTCCTGCCGAGGAGACACATATCCCA
CGAACTGCATTCATGGTAGCCGGCGCTGTTGGTCTCGTTGCCATTGCAGCCATTTGGTGGAGTAGGCATCGGTAG
Transcript >OphauB2|3082
ATGGCTCTGGCTGATGAGACGACGCGCGTCGTGTCCAACTTTGACTTTTCTGACAGTGATGTCAATCGTCATGTT
CGCGAGTTTTTGCGTCAGATGGCCGAGGGCCTGCAAAAGGACGGCACAAGCATCAGTCAGATTCCCACATATGTG
ACGGGAGTTCCAAATGGAACGGAAAAGGGTCTGTATCTGGCTGTTGATCTCGGAGGTACCAATTTTCGAGTCTGC
TCAATCATGCTCAACGGAGACACCACCTTTAACCTCACCTACAACAAGGTCGCTATTCCTAAACATCTCATGGTG
GCCAAAACGGCTAGAGAGCTTTTTGCCTTTTTGGCCAAACAAATCGAGCTATTCCTCCGTGAGCACCATGCCGAG
CATTTCGAGAGCCATACGCGTCGTCGCAACACCAGCAGCACTCCGTTGGGCTATCGCGACGAGCACATCTTCCGT
CTTGGCTTTACCTTTAGCTTCCCCGTTCGACAGCTTGGCATCAACAAGGGCAAACTTATAAGGTGGACCAAGGGC
TTTGACATTCCTGACGCCATCGGGAAAGATGTGTGCCTTTTGCTGCAGGACGAAATTGATCGTTTGCGCCTTCCT
GTCAAGGTGGTGGCGCTCGTCAACGACACTGTAGGGACGCTGATGGCTCGGTCATACACATCAAACGGCAAGCAC
CGGTCTGTCCTGGGTGGCATCTTCGGCACTGGCACCAATGGCGCTTATATTGAGAAGACGGCCAACATTAAAAAG
CCAATAGAGGGCGAGTTCGACACGTCGACGGGAGAAATGGTTGTCAATATGGAATGGGGATCTTTTGACAACCAA
TTGAATGTACTGCCTTCGACTCCGTGGGACAAGTCACTAGATGCTGAAAGCGTAAACCCGGGCATTCACATGTTC
GAAAAGCGCGTCTCGGGCATGTTTTTGGGCGAAATAGTCCGCCGCGCCGTGGTGGACATGATGAAAAACGACGCT
ATCTCGCTCTTCAAGGACGTCAACTCGAGCTTCAACGACTGGGGCACCACGACAAACATCAGCCCTCAGTCAGGC
ATGCTGAAACAGTGGGGTCTGGACAGCGCCATCCTGTCGGTTGCTGCGTCGGACAACAGCCCGGAGCTGTCAACC
CTGCGTCAAGAATTGGAGAATACACTCGACATCTACAACCCTTCGCTTGAAGACGCACAGGCCTTCAAGGCAGTT
GCTGGCGCCGTGGCCCGTCGCGCAGCCAGGCTATCGGCTGTTGCCATTGGTGCCGTGGCTTTGCAGTCGGGCAAA
CTTGACGACCCAGACGAAGAAGTGCTCGATATTGGCGTTGATGGCAGTCTAGTAGAACACTATCCCTTCTTTAGA
GACATGATATACGATGCGCTGGCGGTTATCGAGGGCATTGGACCCAAGGGTGCTGAGAAGATACGTATTGGCATA
GCAAAGGACGGCAGTGGCGTTGGCGCTGCCTTGATTGCGCTCGTAGCGCAACGCATGGAGAAGCCTGGAGACTTT
TTGGCGGACCTGAGAAAGGACATTCGGCGAAGTCTCGAGGCCATGCCGGTTCCTGCCGAGGAGACACATATCCCA
CGAACTGCATTCATGGTAGCCGGCGCTGTTGGTCTCGTTGCCATTGCAGCCATTTGGTGGAGTAGGCATCGGTAG
Gene >OphauB2|3082
ATGGCTCTGGCTGATGAGACGACGCGCGTCGTGTCCAACTTTGACTTTTCTGACAGTGATGTCAATCGTCATGTT
CGCGAGTTTTTGCGTCAGATGGGTGAGTTTGCTAGTGCTTGCGCGCCCTCCGCACATGCTGATGCGCCTCGCCTA
GCCGAGGGCCTGCAAAAGGACGGCACAAGCATCAGTCAGATTCCCACATATGTGACGGGAGTTCCAAATGGAACG
GAAAAGGTAGCTTTCTTGACGTCTCATGTCCATCACACGTCTATATTTCATGGCAAAACTGACGTGCCAATCTTG
CGCCCAAGGGTCTGTATCTGGCTGTTGATCTCGGAGGTACCAATTTTCGAGTCTGCTCAATCATGCTCAACGGAG
ACACCACCTTTAACCTCACCTACAACAAGGTCGCTATTCCTAAACATCTCATGGTGGCCAAAACGGCTAGAGAGC
TTTTTGCCTTTTTGGCCAAACAAATCGAGCTATTCCTCCGTGAGCACCATGCCGAGCATTTCGAGAGCCATACGC
GTCGTCGCAACACCAGCAGCACTCCGTTGGGCTATCGCGACGAGCACATCTTCCGTCTTGGCTTTACCTTTAGCT
TCCCCGTTCGACAGCTTGGCATCAACAAGGGCAAACTTATAAGGTGGACCAAGGGCTTTGACATTCCTGACGCCA
TCGGGAAAGATGTGTGCCTTTTGCTGCAGGACGAAATTGATCGTTTGCGCCTTCCTGTCAAGGTGGTGGCGCTCG
TCAACGACACTGTAGGGACGCTGATGGCTCGGTCATACACATCAAACGGCAAGCACCGGTCTGTCCTGGGTGGCA
TCTTCGGCACTGGCACCAATGGCGCTTATATTGAGAAGACGGCCAACATTAAAAAGCCAATAGAGGGCGAGTTCG
ACACGTCGACGGGAGAAATGGTTGTCAATATGGAATGGGGATCTTTTGACAACCAATTGAATGTACTGCCTTCGA
CTCCGTGGGACAAGTCACTAGATGCTGAAAGCGTAAACCCGGGCATTCACATGTTCGAAAAGCGCGTCTCGGGCA
TGTTTTTGGGCGAAATAGTCCGCCGCGCCGTGGTGGACATGATGAAAAACGACGCTATCTCGCTCTTCAAGGACG
TCAACTCGAGCTTCAACGACTGGGGCACCACGACAAACATCAGCCCTCAGTCAGGCATGCTGAAACAGTGGGGTC
TGGACAGCGCCATCCTGTCGGTTGCTGCGTCGGACAACAGCCCGGAGCTGTCAACCCTGCGTCAAGAATTGGAGA
ATACACTCGACATCTACAACCCTTCGCTTGAAGACGCACAGGCCTTCAAGGCAGTTGCTGGCGCCGTGGCCCGTC
GCGCAGCCAGGCTATCGGCTGTTGCCATTGGTGCCGTGGCTTTGCAGTCGGGCAAACTTGACGACCCAGACGAAG
AAGTGCTCGATATTGGCGTTGATGGCAGTCTAGTAGAACACTATCCCTTCTTTAGAGACATGATATACGATGCGC
TGGCGGTTATCGAGGGCATTGGACCCAAGGGTGCTGAGAAGATACGTATTGGCATAGCAAAGGACGGCAGTGGCG
TTGGCGCTGCCTTGATTGCGCTCGTAGCGCAACGCATGGAGAAGCCTGGAGACTTTTTGGCGGACCTGAGAAAGG
ACATTCGGCGAAGTCTCGAGGCCATGCCGGTTCCTGGTACGTTCCTGACGGCCCAAGTGTATTGCTTGGACTGAC
AATCTCGCAGCCGAGGAGACACATATCCCACGAACTGCATTCATGGTAGCCGGCGCTGTTGGTCTCGTTGCCATT
GCAGCCATTTGGTGGAGTAGGCATCGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail