Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3078
Gene name
LocationContig_20:91482..93299
Strand-
Gene length (bp)1817
Transcript length (bp)1764
Coding sequence length (bp)1764
Protein length (aa) 588

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04258 Peptidase_A22B Signal peptide peptidase 1.2E-38 86 359
PF04258 Peptidase_A22B Signal peptide peptidase 2.5E-18 433 497

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P34248|YKK0_YEAST Probable intramembrane protease YKL100C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YKL100C PE=1 SV=1 36 557 9.0E-23
sp|P49049|IMP2_CAEEL Intramembrane protease 2 OS=Caenorhabditis elegans GN=imp-2 PE=1 SV=1 247 505 1.0E-21
sp|Q6ZGL9|SIP1_ORYSJ Signal peptide peptidase 1 OS=Oryza sativa subsp. japonica GN=SPP1 PE=2 SV=1 231 357 8.0E-19
sp|Q9UTA3|YL8H_SCHPO Probable intramembrane protease C25B8.17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC25B8.17 PE=3 SV=1 247 498 1.0E-18
sp|B9FJ61|SIP2_ORYSJ Signal peptide peptidase 2 OS=Oryza sativa subsp. japonica GN=SPP2 PE=2 SV=1 267 357 2.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P34248|YKK0_YEAST Probable intramembrane protease YKL100C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YKL100C PE=1 SV=1 36 557 9.0E-23
sp|P49049|IMP2_CAEEL Intramembrane protease 2 OS=Caenorhabditis elegans GN=imp-2 PE=1 SV=1 247 505 1.0E-21
sp|Q6ZGL9|SIP1_ORYSJ Signal peptide peptidase 1 OS=Oryza sativa subsp. japonica GN=SPP1 PE=2 SV=1 231 357 8.0E-19
sp|Q9UTA3|YL8H_SCHPO Probable intramembrane protease C25B8.17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC25B8.17 PE=3 SV=1 247 498 1.0E-18
sp|B9FJ61|SIP2_ORYSJ Signal peptide peptidase 2 OS=Oryza sativa subsp. japonica GN=SPP2 PE=2 SV=1 267 357 2.0E-18
sp|O81062|SIP_ARATH Signal peptide peptidase OS=Arabidopsis thaliana GN=SPP PE=2 SV=1 267 357 5.0E-18
sp|Q9CUS9|SPPL3_MOUSE Signal peptide peptidase-like 3 OS=Mus musculus GN=Sppl3 PE=1 SV=3 245 493 3.0E-15
sp|Q8TCT6|SPPL3_HUMAN Signal peptide peptidase-like 3 OS=Homo sapiens GN=SPPL3 PE=1 SV=1 245 493 3.0E-15
sp|Q8TCT9|HM13_HUMAN Minor histocompatibility antigen H13 OS=Homo sapiens GN=HM13 PE=1 SV=1 291 359 1.0E-11
sp|Q9D8V0|HM13_MOUSE Minor histocompatibility antigen H13 OS=Mus musculus GN=Hm13 PE=1 SV=1 291 359 2.0E-11
sp|Q7G7C7|SIPL1_ORYSJ Signal peptide peptidase-like 1 OS=Oryza sativa subsp. japonica GN=SPPL1 PE=2 SV=1 252 493 2.0E-11
sp|Q8TCT9|HM13_HUMAN Minor histocompatibility antigen H13 OS=Homo sapiens GN=HM13 PE=1 SV=1 438 524 3.0E-09
sp|B9FJ61|SIP2_ORYSJ Signal peptide peptidase 2 OS=Oryza sativa subsp. japonica GN=SPP2 PE=2 SV=1 439 518 7.0E-09
sp|Q9JJF9|SPP2A_MOUSE Signal peptide peptidase-like 2A OS=Mus musculus GN=Sppl2a PE=1 SV=2 439 505 8.0E-09
sp|Q8TCT8|SPP2A_HUMAN Signal peptide peptidase-like 2A OS=Homo sapiens GN=SPPL2A PE=1 SV=2 439 509 2.0E-08
sp|Q6ZGL9|SIP1_ORYSJ Signal peptide peptidase 1 OS=Oryza sativa subsp. japonica GN=SPP1 PE=2 SV=1 439 498 3.0E-08
sp|Q9D8V0|HM13_MOUSE Minor histocompatibility antigen H13 OS=Mus musculus GN=Hm13 PE=1 SV=1 437 502 6.0E-08
sp|Q5N808|SIPL3_ORYSJ Signal peptide peptidase-like 3 OS=Oryza sativa subsp. japonica GN=SPPL3 PE=2 SV=1 439 493 5.0E-07
sp|Q0WMJ8|SIPL4_ARATH Signal peptide peptidase-like 4 OS=Arabidopsis thaliana GN=SPPL4 PE=2 SV=1 439 497 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004190 aspartic-type endopeptidase activity Yes
GO:0016021 integral component of membrane Yes
GO:0003824 catalytic activity No
GO:0110165 cellular anatomical entity No
GO:0003674 molecular_function No
GO:0070001 aspartic-type peptidase activity No
GO:0016787 hydrolase activity No
GO:0008233 peptidase activity No
GO:0031224 intrinsic component of membrane No
GO:0005575 cellular_component No
GO:0140096 catalytic activity, acting on a protein No
GO:0004175 endopeptidase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.5

Transmembrane Domains

Domain # Start End Length
1 98 120 22
2 135 157 22
3 247 269 22
4 289 311 22
5 439 461 22
6 466 484 18

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3078
MSTNSSATGSILSGLDSVNATLGGSDEASTALGLVHNLHFLLLEAKLLASALGIIYLGSHASLRRPPSASPSASA
KDKTCRKQDKEENAIQGLEPSDAIIFPLLASMILVGLYYLIQWLNDPTLLNKILRWYMSTMSTASLLTLYSHFMQ
LGTSLLFPRYWRGRDGNLRKVSQSTRSVSVCDDVGNAIAGAPPESNPLPGSLAVFASSSRTRAVAWELRGLLYRP
WDLDVFIHGIVEHKAQIKLAHVMAFLLSVATALTYFSTSWPLLSNVLGSGMCYASFFVLSPTDFLTGSLVLVGLF
VYDVVMVFYTPYMVTVATQLDIPIKLTFQSAKRQSMLGLGDIVIPGMVIAWALRLDLWLFYLTKVKYEATDLKIM
QKDATSGELVIKREKKHKEIKARYVDVKGRWGDALWTRGNFFLGRAPRQQQPTELAASVFPKTYFKAAMTGYLVG
MMVTLTMLLVFKQGQPALLYLVPGVLGALLVTALRRGEMKKVWMYTEDGSLDTMDVVVDLDGEGQAAKTIGKVEN
GIVDLTKGDGSRGSDDSGDRKGDNAKEESDKEASTRPTGRVAKGGHRVLLLSLEAPSENEAD*
Coding >OphauB2|3078
ATGTCGACCAACTCGAGCGCCACAGGGTCTATCTTGAGCGGGCTGGACAGCGTCAACGCGACTCTGGGTGGCAGC
GACGAGGCGTCTACGGCGCTCGGCCTCGTTCACAACTTGCACTTTTTGCTACTAGAGGCCAAGCTCCTCGCCAGC
GCCCTTGGAATCATCTATCTGGGCTCCCATGCCTCACTACGCAGACCGCCCTCGGCGTCTCCCAGCGCCTCGGCC
AAGGATAAGACATGCCGGAAACAGGACAAGGAGGAAAATGCAATACAGGGGCTCGAGCCCAGCGACGCCATCATC
TTTCCTCTGCTCGCTTCCATGATACTGGTTGGCCTGTACTATCTGATTCAATGGCTTAATGACCCAACTCTGCTC
AACAAGATTCTGAGATGGTACATGTCCACCATGTCGACGGCGAGCCTACTGACGCTCTACTCGCATTTCATGCAG
CTGGGCACGTCGCTGCTCTTTCCACGCTACTGGCGCGGCCGTGACGGCAACCTGCGCAAGGTCAGCCAGAGCACC
AGGTCCGTGTCGGTGTGCGATGACGTGGGTAATGCCATAGCTGGCGCACCGCCCGAGAGCAATCCGCTTCCTGGC
TCCCTGGCCGTCTTTGCCTCGTCGAGCCGGACCCGTGCCGTGGCCTGGGAGCTCCGCGGGCTTCTCTATAGGCCC
TGGGACTTGGACGTTTTCATCCACGGCATCGTGGAGCACAAGGCTCAAATCAAGCTGGCTCACGTCATGGCCTTT
CTGCTGTCTGTGGCTACTGCGCTCACGTACTTTTCCACCTCGTGGCCCCTCTTGTCCAATGTTTTGGGCTCTGGC
ATGTGCTATGCCTCCTTTTTTGTCCTCTCGCCCACCGACTTTCTCACGGGCTCGCTAGTGCTGGTTGGACTCTTC
GTCTACGACGTCGTCATGGTCTTTTATACCCCTTATATGGTGACGGTGGCAACTCAGCTCGACATCCCAATCAAG
CTAACGTTTCAGTCGGCCAAGCGTCAGAGTATGCTTGGACTGGGCGACATTGTCATTCCCGGCATGGTGATTGCG
TGGGCGCTCCGCCTGGATTTGTGGCTTTTTTATCTGACCAAGGTCAAGTACGAGGCCACGGATCTCAAGATTATG
CAAAAGGACGCCACGTCTGGGGAGCTGGTAATCAAGAGGGAGAAGAAGCACAAGGAGATCAAGGCACGCTATGTC
GACGTCAAGGGCAGATGGGGCGACGCGTTGTGGACGCGTGGCAATTTCTTCTTGGGACGAGCGCCGCGGCAGCAG
CAGCCGACAGAGCTGGCAGCCTCTGTCTTCCCCAAGACGTACTTCAAGGCGGCCATGACGGGCTACTTGGTGGGA
ATGATGGTGACGCTGACCATGTTGCTTGTATTCAAGCAAGGCCAGCCAGCATTACTCTATCTGGTGCCAGGAGTG
CTGGGAGCGCTCTTGGTGACGGCTCTGAGACGCGGCGAGATGAAAAAGGTGTGGATGTACACCGAGGATGGCAGT
CTCGATACCATGGATGTGGTGGTGGACCTTGATGGGGAGGGGCAGGCTGCCAAGACGATTGGCAAGGTGGAGAAT
GGCATTGTGGATTTGACAAAGGGGGACGGCAGCAGAGGCTCAGACGACTCGGGGGATCGCAAGGGAGACAATGCC
AAGGAGGAGAGCGACAAGGAGGCATCGACGCGGCCAACAGGGCGCGTGGCGAAAGGCGGGCACCGTGTGTTGCTA
CTTTCGCTCGAAGCGCCCTCTGAGAATGAGGCTGACTAG
Transcript >OphauB2|3078
ATGTCGACCAACTCGAGCGCCACAGGGTCTATCTTGAGCGGGCTGGACAGCGTCAACGCGACTCTGGGTGGCAGC
GACGAGGCGTCTACGGCGCTCGGCCTCGTTCACAACTTGCACTTTTTGCTACTAGAGGCCAAGCTCCTCGCCAGC
GCCCTTGGAATCATCTATCTGGGCTCCCATGCCTCACTACGCAGACCGCCCTCGGCGTCTCCCAGCGCCTCGGCC
AAGGATAAGACATGCCGGAAACAGGACAAGGAGGAAAATGCAATACAGGGGCTCGAGCCCAGCGACGCCATCATC
TTTCCTCTGCTCGCTTCCATGATACTGGTTGGCCTGTACTATCTGATTCAATGGCTTAATGACCCAACTCTGCTC
AACAAGATTCTGAGATGGTACATGTCCACCATGTCGACGGCGAGCCTACTGACGCTCTACTCGCATTTCATGCAG
CTGGGCACGTCGCTGCTCTTTCCACGCTACTGGCGCGGCCGTGACGGCAACCTGCGCAAGGTCAGCCAGAGCACC
AGGTCCGTGTCGGTGTGCGATGACGTGGGTAATGCCATAGCTGGCGCACCGCCCGAGAGCAATCCGCTTCCTGGC
TCCCTGGCCGTCTTTGCCTCGTCGAGCCGGACCCGTGCCGTGGCCTGGGAGCTCCGCGGGCTTCTCTATAGGCCC
TGGGACTTGGACGTTTTCATCCACGGCATCGTGGAGCACAAGGCTCAAATCAAGCTGGCTCACGTCATGGCCTTT
CTGCTGTCTGTGGCTACTGCGCTCACGTACTTTTCCACCTCGTGGCCCCTCTTGTCCAATGTTTTGGGCTCTGGC
ATGTGCTATGCCTCCTTTTTTGTCCTCTCGCCCACCGACTTTCTCACGGGCTCGCTAGTGCTGGTTGGACTCTTC
GTCTACGACGTCGTCATGGTCTTTTATACCCCTTATATGGTGACGGTGGCAACTCAGCTCGACATCCCAATCAAG
CTAACGTTTCAGTCGGCCAAGCGTCAGAGTATGCTTGGACTGGGCGACATTGTCATTCCCGGCATGGTGATTGCG
TGGGCGCTCCGCCTGGATTTGTGGCTTTTTTATCTGACCAAGGTCAAGTACGAGGCCACGGATCTCAAGATTATG
CAAAAGGACGCCACGTCTGGGGAGCTGGTAATCAAGAGGGAGAAGAAGCACAAGGAGATCAAGGCACGCTATGTC
GACGTCAAGGGCAGATGGGGCGACGCGTTGTGGACGCGTGGCAATTTCTTCTTGGGACGAGCGCCGCGGCAGCAG
CAGCCGACAGAGCTGGCAGCCTCTGTCTTCCCCAAGACGTACTTCAAGGCGGCCATGACGGGCTACTTGGTGGGA
ATGATGGTGACGCTGACCATGTTGCTTGTATTCAAGCAAGGCCAGCCAGCATTACTCTATCTGGTGCCAGGAGTG
CTGGGAGCGCTCTTGGTGACGGCTCTGAGACGCGGCGAGATGAAAAAGGTGTGGATGTACACCGAGGATGGCAGT
CTCGATACCATGGATGTGGTGGTGGACCTTGATGGGGAGGGGCAGGCTGCCAAGACGATTGGCAAGGTGGAGAAT
GGCATTGTGGATTTGACAAAGGGGGACGGCAGCAGAGGCTCAGACGACTCGGGGGATCGCAAGGGAGACAATGCC
AAGGAGGAGAGCGACAAGGAGGCATCGACGCGGCCAACAGGGCGCGTGGCGAAAGGCGGGCACCGTGTGTTGCTA
CTTTCGCTCGAAGCGCCCTCTGAGAATGAGGCTGACTAG
Gene >OphauB2|3078
ATGTCGACCAACTCGAGCGCCACAGGGTCTATCTTGAGCGGGCTGGACAGCGTCAACGCGACTCTGGGTGGCAGC
GACGAGGCGTCTACGGCGCTCGGCCTCGTTCACAACTTGCACTTTTTGCTACTAGAGGCCAAGCTCCTCGCCAGC
GCCCTTGGAATCATCTATCTGGGCTCCCATGCCTCACTACGCAGACCGCCCTCGGCGTCTCCCAGCGCCTCGGCC
AAGGATAAGACATGCCGGAAACAGGACAAGGAGGAAAATGCAATACAGGGGCTCGAGCCCAGCGACGCCATCATC
TTTCCTCTGCTCGCTTCCATGATACTGGTTGGCCTGTACTATCTGATTCAATGGCTTAATGACCCAACTCTGCTC
AACAAGATTCTGAGATGGTACATGTCCACCATGTCGACGGCGAGCCTACTGACGCTCTACTCGCATTTCATGCAG
CTGGGCACGTCGCTGCTCTTTCCACGCTACTGGCGCGGCCGTGACGGCAACCTGCGCAAGGTCAGCCAGAGCACC
AGGTCCGTGTCGGTGTGCGATGACGTGGGTAATGCCATAGCTGGCGCACCGCCCGAGAGCAATCCGCTTCCTGGC
TCCCTGGCCGTCTTTGCCTCGTCGAGCCGGACCCGTGCCGTGGCCTGGGAGCTCCGCGGGCTTCTCTATAGGCCC
TGGGACTTGGACGTTTTCATCCACGGCATCGTGGAGCACAAGGCTCAAATCAAGCTGGCTCACGTCATGGCCTTT
CTGCTGTCTGTGGCTACTGCGCTCACGTACTTTTCCACCTCGTGGCCCCTCTTGTCCAATGTTTTGGGCTCTGGC
ATGTGCTATGCCTCCTTTTTTGTCCTCTCGCCCACCGACTTTCTCACGGGCTCGCTAGTGCTGGTTGGACTCTTC
GTCTACGACGTCGTCATGGTCTTTTATACGTGAGTTGGGGTCAAGAGTGGCAGCAAATATACACATGCTGACCCA
GGCGCAGCCCTTATATGGTGACGGTGGCAACTCAGCTCGACATCCCAATCAAGCTAACGTTTCAGTCGGCCAAGC
GTCAGAGTATGCTTGGACTGGGCGACATTGTCATTCCCGGCATGGTGATTGCGTGGGCGCTCCGCCTGGATTTGT
GGCTTTTTTATCTGACCAAGGTCAAGTACGAGGCCACGGATCTCAAGATTATGCAAAAGGACGCCACGTCTGGGG
AGCTGGTAATCAAGAGGGAGAAGAAGCACAAGGAGATCAAGGCACGCTATGTCGACGTCAAGGGCAGATGGGGCG
ACGCGTTGTGGACGCGTGGCAATTTCTTCTTGGGACGAGCGCCGCGGCAGCAGCAGCCGACAGAGCTGGCAGCCT
CTGTCTTCCCCAAGACGTACTTCAAGGCGGCCATGACGGGCTACTTGGTGGGAATGATGGTGACGCTGACCATGT
TGCTTGTATTCAAGCAAGGCCAGCCAGCATTACTCTATCTGGTGCCAGGAGTGCTGGGAGCGCTCTTGGTGACGG
CTCTGAGACGCGGCGAGATGAAAAAGGTGTGGATGTACACCGAGGATGGCAGTCTCGATACCATGGATGTGGTGG
TGGACCTTGATGGGGAGGGGCAGGCTGCCAAGACGATTGGCAAGGTGGAGAATGGCATTGTGGATTTGACAAAGG
GGGACGGCAGCAGAGGCTCAGACGACTCGGGGGATCGCAAGGGAGACAATGCCAAGGAGGAGAGCGACAAGGAGG
CATCGACGCGGCCAACAGGGCGCGTGGCGAAAGGCGGGCACCGTGTGTTGCTACTTTCGCTCGAAGCGCCCTCTG
AGAATGAGGCTGACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail