Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3063
Gene name
LocationContig_20:29296..36298
Strand-
Gene length (bp)7002
Transcript length (bp)7002
Coding sequence length (bp)7002
Protein length (aa) 2334

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00109 ketoacyl-synt Beta-ketoacyl synthase, N-terminal domain 3.7E-73 3 253
PF08659 KR KR domain 2.0E-50 1953 2131
PF00698 Acyl_transf_1 Acyl transferase domain 1.2E-49 551 842
PF14765 PS-DH Polyketide synthase dehydratase 1.5E-48 927 1218
PF02801 Ketoacyl-synt_C Beta-ketoacyl synthase, C-terminal domain 2.0E-35 262 378
PF16197 KAsynt_C_assoc Ketoacyl-synthetase C-terminal extension 5.7E-19 381 519
PF00106 adh_short short chain dehydrogenase 1.0E-10 1956 2122

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 5 1171 0.0E+00
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 3 1239 0.0E+00
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 2 1180 0.0E+00
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 2 1167 4.0E-179
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 2 1167 4.0E-177
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 5 1171 0.0E+00
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 3 1239 0.0E+00
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 2 1180 0.0E+00
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 2 1167 4.0E-179
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 2 1167 4.0E-177
sp|P9WQE3|PPSD_MYCTU Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsD PE=1 SV=1 3 1153 5.0E-132
sp|P9WQE2|PPSD_MYCTO Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsD PE=3 SV=1 3 1153 5.0E-132
sp|Q7TXL7|PPSD_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsD PE=3 SV=1 3 1153 1.0E-131
sp|P9WQE6|PPSA_MYCTO Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsA PE=3 SV=1 1 806 2.0E-127
sp|Q7TXM0|PPSA_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsA PE=1 SV=1 1 806 3.0E-127
sp|P9WQE7|PPSA_MYCTU Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsA PE=1 SV=1 1 806 3.0E-127
sp|Q869W9|PKS16_DICDI Probable polyketide synthase 16 OS=Dictyostelium discoideum GN=pks16 PE=2 SV=1 3 1196 4.0E-127
sp|Q7TXL9|PPSB_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsB PE=1 SV=1 1 917 8.0E-127
sp|P9WQE5|PPSB_MYCTU Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsB PE=1 SV=1 1 917 9.0E-127
sp|P9WQE4|PPSB_MYCTO Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsB PE=3 SV=1 1 917 9.0E-127
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 2 1151 7.0E-126
sp|Q869X2|PKS17_DICDI Probable polyketide synthase 17 OS=Dictyostelium discoideum GN=pks17 PE=3 SV=1 3 1186 1.0E-124
sp|B2HIL7|MSL7_MYCMM Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=pks15/1 PE=1 SV=1 3 1151 7.0E-124
sp|Q7TXK8|MSL7_MYCBO Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks15/1 PE=1 SV=1 3 1151 3.0E-123
sp|P96202|PPSC_MYCTU Phthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsC PE=1 SV=2 2 1153 2.0E-122
sp|Q7TXL8|PPSC_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsC PE=1 SV=1 2 1153 2.0E-122
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 5 909 6.0E-121
sp|Q55E72|PKS1_DICDI Probable polyketide synthase 1 OS=Dictyostelium discoideum GN=stlA PE=1 SV=1 4 1154 1.0E-120
sp|Q02251|MCAS_MYCBO Mycocerosic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mas PE=1 SV=2 5 1153 8.0E-118
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 3 830 9.0E-118
sp|P9WQE9|PHAS_MYCTU Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks2 PE=1 SV=1 5 1153 5.0E-117
sp|P9WQE8|PHAS_MYCTO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pks2 PE=3 SV=1 5 1153 5.0E-117
sp|A5U9F4|PHAS_MYCTA Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pks2 PE=3 SV=1 5 1153 5.0E-117
sp|Q7TVK8|PHAS_MYCBO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks2 PE=3 SV=1 5 1153 5.0E-117
sp|A1KQG0|PHAS_MYCBP Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=pks2 PE=3 SV=1 5 1153 7.0E-117
sp|B4XYB8|AZIB_STREG 5-methyl-1-naphthoate synthase OS=Streptomyces sahachiroi GN=aziB PE=1 SV=1 3 979 1.0E-116
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 2 842 3.0E-116
sp|Q559A9|PKS13_DICDI Probable polyketide synthase 13 OS=Dictyostelium discoideum GN=pks13 PE=3 SV=1 2 995 2.0E-115
sp|Q54QD3|PKS22_DICDI Probable polyketide synthase 22 OS=Dictyostelium discoideum GN=pks22 PE=3 SV=1 5 977 4.0E-115
sp|Q54ED6|PKS41_DICDI Probable polyketide synthase 41 OS=Dictyostelium discoideum GN=pks41 PE=3 SV=1 5 993 5.0E-115
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 3 809 1.0E-114
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 2 842 1.0E-113
sp|P22367|MSAS_PENPA 6-methylsalicylic acid synthase OS=Penicillium patulum PE=1 SV=1 1 977 3.0E-112
sp|Q54QD1|PKS23_DICDI Probable polyketide synthase 23 OS=Dictyostelium discoideum GN=pks23 PE=3 SV=1 5 1127 9.0E-112
sp|B0G138|PKS21_DICDI Probable polyketide synthase 21 OS=Dictyostelium discoideum GN=pks21 PE=3 SV=1 3 977 4.0E-110
sp|Q54IX3|PKS26_DICDI Probable polyketide synthase 26 OS=Dictyostelium discoideum GN=pks26 PE=3 SV=1 1 995 1.0E-108
sp|Q54ED7|PKS40_DICDI Probable polyketide synthase 40 OS=Dictyostelium discoideum GN=pks40 PE=3 SV=1 5 1103 2.0E-108
sp|Q55DM7|PKS2_DICDI Probable polyketide synthase 2 OS=Dictyostelium discoideum GN=pks2 PE=3 SV=1 4 1151 3.0E-108
sp|Q54FD2|PKS38_DICDI Probable polyketide synthase 38 OS=Dictyostelium discoideum GN=pks38 PE=3 SV=1 3 1150 9.0E-108
sp|Q54T36|PKS19_DICDI Probable polyketide synthase 19 OS=Dictyostelium discoideum GN=pks19 PE=3 SV=1 2 977 9.0E-107
sp|Q54FQ2|PKS30_DICDI Probable polyketide synthase 30 OS=Dictyostelium discoideum GN=pks30 PE=3 SV=1 4 1139 3.0E-106
sp|Q54FN7|PKS33_DICDI Probable polyketide synthase 33 OS=Dictyostelium discoideum GN=pks33 PE=3 SV=2 4 1150 4.0E-106
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 5 830 2.0E-105
sp|Q54FQ3|PKS29_DICDI Probable polyketide synthase 29 OS=Dictyostelium discoideum GN=pks29 PE=3 SV=1 5 1150 4.0E-105
sp|Q54FQ1|PKS31_DICDI Probable polyketide synthase 31 OS=Dictyostelium discoideum GN=pks31 PE=3 SV=1 6 1150 5.0E-105
sp|Q558Y6|PKS14_DICDI Probable polyketide synthase 14 OS=Dictyostelium discoideum GN=pks14 PE=3 SV=2 2 1106 2.0E-103
sp|Q54FN2|PKS34_DICDI Probable polyketide synthase 34 OS=Dictyostelium discoideum GN=pks34 PE=3 SV=1 4 1150 2.0E-103
sp|B0G100|PKS7_DICDI Probable polyketide synthase 7 OS=Dictyostelium discoideum GN=pks7 PE=3 SV=1 1 981 2.0E-102
sp|Q54FC8|PKS39_DICDI Probable polyketide synthase 39 OS=Dictyostelium discoideum GN=pks39 PE=3 SV=1 3 1150 2.0E-102
sp|Q55CN6|PKS3_DICDI Probable polyketide synthase 3 OS=Dictyostelium discoideum GN=pks3 PE=3 SV=1 12 977 6.0E-102
sp|Q86JI5|PKS5_DICDI Probable polyketide synthase 5 OS=Dictyostelium discoideum GN=pks5 PE=2 SV=1 5 981 7.0E-102
sp|B0G101|PKS8_DICDI Probable polyketide synthase 8/35 OS=Dictyostelium discoideum GN=pks8 PE=3 SV=1 5 981 3.0E-101
sp|Q86AE3|PKS9_DICDI Probable polyketide synthase 9/36 OS=Dictyostelium discoideum GN=pks9 PE=2 SV=1 5 981 3.0E-101
sp|P19096|FAS_MOUSE Fatty acid synthase OS=Mus musculus GN=Fasn PE=1 SV=2 3 1222 3.0E-101
sp|Q54B51|PKS44_DICDI Probable polyketide synthase 44 OS=Dictyostelium discoideum GN=pks44 PE=3 SV=1 4 1179 6.0E-101
sp|Q71SP7|FAS_BOVIN Fatty acid synthase OS=Bos taurus GN=FASN PE=2 SV=1 3 1229 2.0E-100
sp|Q54B49|PKS45_DICDI Probable polyketide synthase 45 OS=Dictyostelium discoideum GN=pks45 PE=3 SV=2 4 978 7.0E-100
sp|Q54FP8|PKS32_DICDI Probable polyketide synthase 32 OS=Dictyostelium discoideum GN=pks32 PE=3 SV=1 4 1149 7.0E-100
sp|P49327|FAS_HUMAN Fatty acid synthase OS=Homo sapiens GN=FASN PE=1 SV=3 3 1105 7.0E-100
sp|Q54G30|PKS27_DICDI Probable polyketide synthase 27 OS=Dictyostelium discoideum GN=pks27 PE=3 SV=1 4 976 1.0E-99
sp|B0G103|PKS10_DICDI Probable polyketide synthase 10 OS=Dictyostelium discoideum GN=pks10 PE=3 SV=1 2 989 1.0E-98
sp|Q54KU3|PKS25_DICDI Probable polyketide synthase 25 OS=Dictyostelium discoideum GN=pks25 PE=3 SV=1 5 977 1.0E-98
sp|B0G0Z9|PKS6_DICDI Probable polyketide synthase 6 OS=Dictyostelium discoideum GN=pks6 PE=3 SV=1 1 981 3.0E-98
sp|Q12053|PKSL1_ASPPA Noranthrone synthase OS=Aspergillus parasiticus GN=pksL1 PE=1 SV=1 2 908 3.0E-98
sp|P12785|FAS_RAT Fatty acid synthase OS=Rattus norvegicus GN=Fasn PE=1 SV=3 3 1105 3.0E-98
sp|Q12397|STCA_EMENI Putative sterigmatocystin biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcA PE=3 SV=2 5 903 5.0E-98
sp|P96284|PKS15_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks15 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks15 PE=1 SV=2 3 425 5.0E-98
sp|B0G170|PKS28_DICDI Probable polyketide synthase 28 OS=Dictyostelium discoideum GN=pks28 PE=3 SV=1 4 831 5.0E-98
sp|Q54D44|PKS42_DICDI Probable polyketide synthase 42 OS=Dictyostelium discoideum GN=pks42 PE=3 SV=2 5 1150 4.0E-96
sp|P12276|FAS_CHICK Fatty acid synthase OS=Gallus gallus GN=FASN PE=1 SV=5 3 839 2.0E-93
sp|Q03149|WA_EMENI Conidial yellow pigment biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=wA PE=1 SV=2 5 838 5.0E-90
sp|Q7TXL6|PPSE_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsE PE=1 SV=1 5 913 2.0E-85
sp|P9WQE1|PPSE_MYCTU Phthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsE PE=1 SV=1 5 913 2.0E-85
sp|P9WQE0|PPSE_MYCTO Phthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsE PE=3 SV=1 5 913 2.0E-85
sp|Q54FI3|PKS37_DICDI Probable polyketide synthase 37 OS=Dictyostelium discoideum GN=stlB PE=2 SV=1 2 418 1.0E-82
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 5 532 6.0E-80
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 3 533 9.0E-80
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 3 530 1.0E-79
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 1 425 3.0E-79
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 3 429 8.0E-79
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 4 533 2.0E-77
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 4 430 4.0E-71
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 4 530 7.0E-69
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 3 536 2.0E-68
sp|Q558W4|PKS15_DICDI Probable polyketide synthase 15 OS=Dictyostelium discoideum GN=pks15 PE=3 SV=2 3 427 3.0E-68
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 3 427 6.0E-68
sp|Q54KU5|PKS24_DICDI Probable polyketide synthase 24 OS=Dictyostelium discoideum GN=pks24 PE=3 SV=1 5 427 7.0E-67
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 3 427 3.0E-65
sp|P36189|FAS_ANSAN Fatty acid synthase (Fragment) OS=Anser anser anser GN=FASN PE=1 SV=1 3 370 7.0E-62
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 3 532 1.0E-61
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 3 533 2.0E-61
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 1393 2323 2.0E-58
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 1 426 6.0E-58
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 3 525 2.0E-57
sp|O31784|PKSR_BACSU Polyketide synthase PksR OS=Bacillus subtilis (strain 168) GN=pksR PE=1 SV=2 5 526 2.0E-56
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 3 426 2.0E-54
sp|O31784|PKSR_BACSU Polyketide synthase PksR OS=Bacillus subtilis (strain 168) GN=pksR PE=1 SV=2 3 427 5.0E-51
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 500 943 1.0E-39
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 1949 2320 7.0E-34
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 506 840 2.0E-26
sp|P96285|PKS1_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks1 PE=1 SV=4 509 1151 2.0E-25
sp|P96202|PPSC_MYCTU Phthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsC PE=1 SV=2 1604 2130 4.0E-25
sp|Q7TXL8|PPSC_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsC PE=1 SV=1 1604 2130 4.0E-25
sp|Q02251|MCAS_MYCBO Mycocerosic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mas PE=1 SV=2 1511 2157 6.0E-25
sp|Q54FI3|PKS37_DICDI Probable polyketide synthase 37 OS=Dictyostelium discoideum GN=stlB PE=2 SV=1 1663 2152 4.0E-24
sp|A1KQG0|PHAS_MYCBP Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=pks2 PE=3 SV=1 1508 2303 9.0E-24
sp|P9WQE9|PHAS_MYCTU Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks2 PE=1 SV=1 1508 2303 1.0E-23
sp|P9WQE8|PHAS_MYCTO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pks2 PE=3 SV=1 1508 2303 1.0E-23
sp|A5U9F4|PHAS_MYCTA Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pks2 PE=3 SV=1 1508 2303 1.0E-23
sp|Q7TVK8|PHAS_MYCBO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks2 PE=3 SV=1 1508 2303 1.0E-23
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 1970 2316 3.0E-23
sp|P04684|NODE_RHILT Nodulation protein E OS=Rhizobium leguminosarum bv. trifolii GN=nodE PE=3 SV=2 1 421 6.0E-23
sp|Q05356|KAS1_STRHA Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces halstedii GN=sch1 PE=3 SV=1 1 425 7.0E-23
sp|Q02578|KAS1_STRCN Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces cyaneus GN=curA PE=3 SV=1 1 430 1.0E-22
sp|P23155|KAS1_STRCO Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5318 PE=3 SV=1 2 432 1.0E-22
sp|Q83E37|FABF_COXBU 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=fabF PE=1 SV=1 2 425 2.0E-22
sp|P55338|FABF_VIBHA 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Vibrio harveyi GN=fabF PE=3 SV=2 2 429 4.0E-22
sp|P06231|NOE4_RHIML Nodulation protein E OS=Rhizobium meliloti GN=nodE PE=3 SV=1 65 421 9.0E-22
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 552 977 1.0E-21
sp|Q9KQH9|FABF_VIBCH 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fabF PE=1 SV=3 2 425 1.0E-21
sp|B2HIL7|MSL7_MYCMM Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=pks15/1 PE=1 SV=1 1665 2315 2.0E-21
sp|P06230|NODE_RHIME Nodulation protein E OS=Rhizobium meliloti (strain 1021) GN=nodE PE=3 SV=1 1 421 2.0E-21
sp|P16538|KAS1_STRGA Tetracenomycin C polyketide putative beta-ketoacyl synthase 1 OS=Streptomyces glaucescens GN=tcmK PE=3 SV=1 2 425 3.0E-21
sp|Q7TXK8|MSL7_MYCBO Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks15/1 PE=1 SV=1 1665 2315 1.0E-20
sp|P49327|FAS_HUMAN Fatty acid synthase OS=Homo sapiens GN=FASN PE=1 SV=3 1721 2139 3.0E-20
sp|Q558W4|PKS15_DICDI Probable polyketide synthase 15 OS=Dictyostelium discoideum GN=pks15 PE=3 SV=2 551 977 4.0E-20
sp|Q54FI3|PKS37_DICDI Probable polyketide synthase 37 OS=Dictyostelium discoideum GN=stlB PE=2 SV=1 549 1150 6.0E-20
sp|Q9D404|OXSM_MOUSE 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Mus musculus GN=Oxsm PE=1 SV=1 1 421 6.0E-20
sp|P96285|PKS1_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks1 PE=1 SV=4 1665 2315 8.0E-20
sp|P39525|CEM1_YEAST 3-oxoacyl-[acyl-carrier-protein] synthase homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CEM1 PE=1 SV=1 83 430 9.0E-20
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 1663 2129 2.0E-19
sp|Q02059|KASA_STRCO Actinorhodin polyketide putative beta-ketoacyl synthase 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5087 PE=1 SV=2 1 428 2.0E-19
sp|P23902|KASC1_HORVU 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic OS=Hordeum vulgare GN=KAS12 PE=1 SV=1 128 425 2.0E-19
sp|P52410|KASC1_ARATH 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic OS=Arabidopsis thaliana GN=KAS1 PE=2 SV=2 15 423 2.0E-19
sp|P72331|NODE_RHIS3 Nodulation protein E OS=Rhizobium sp. (strain N33) GN=nodE PE=3 SV=1 155 421 2.0E-19
sp|Q0VCA7|OXSM_BOVIN 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Bos taurus GN=OXSM PE=2 SV=1 1 421 4.0E-19
sp|P0AAI8|FABF_SHIFL 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Shigella flexneri GN=fabF PE=3 SV=2 151 427 5.0E-19
sp|P0AAI5|FABF_ECOLI 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Escherichia coli (strain K12) GN=fabF PE=1 SV=2 151 427 5.0E-19
sp|P0AAI6|FABF_ECOL6 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fabF PE=3 SV=2 151 427 5.0E-19
sp|P0AAI7|FABF_ECO57 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Escherichia coli O157:H7 GN=fabF PE=3 SV=2 151 427 5.0E-19
sp|P04683|NODE_RHILV Nodulation protein E OS=Rhizobium leguminosarum bv. viciae GN=nodE PE=3 SV=2 155 421 6.0E-19
sp|Q55E72|PKS1_DICDI Probable polyketide synthase 1 OS=Dictyostelium discoideum GN=stlA PE=1 SV=1 1515 2151 2.0E-18
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 1954 2321 3.0E-18
sp|P0A953|FABB_ECOLI 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Escherichia coli (strain K12) GN=fabB PE=1 SV=1 162 425 3.0E-18
sp|P0A954|FABB_ECOL6 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fabB PE=3 SV=1 162 425 3.0E-18
sp|P16540|KAS1_STRVN Granaticin polyketide putative beta-ketoacyl synthase 1 OS=Streptomyces violaceoruber GN=gra-orf1 PE=3 SV=1 1 425 5.0E-18
sp|Q9NWU1|OXSM_HUMAN 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Homo sapiens GN=OXSM PE=1 SV=1 5 425 8.0E-18
sp|Q9C9P4|KASC2_ARATH 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic OS=Arabidopsis thaliana GN=KAS2 PE=1 SV=1 67 425 2.0E-17
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 1954 2321 3.0E-17
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 1951 2155 5.0E-17
sp|P56902|FABF_RHIME 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Rhizobium meliloti (strain 1021) GN=fabF PE=3 SV=2 111 431 9.0E-17
sp|B4XYB8|AZIB_STREG 5-methyl-1-naphthoate synthase OS=Streptomyces sahachiroi GN=aziB PE=1 SV=1 1951 2331 1.0E-16
sp|O94297|OXSM_SCHPO Putative 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC887.13c PE=3 SV=1 151 427 1.0E-16
sp|Q71SP7|FAS_BOVIN Fatty acid synthase OS=Bos taurus GN=FASN PE=2 SV=1 1721 2139 2.0E-16
sp|P12276|FAS_CHICK Fatty acid synthase OS=Gallus gallus GN=FASN PE=1 SV=5 1686 2137 3.0E-16
sp|P43678|KAS1_STRRM Oxytetracycline polyketide putative beta-ketoacyl synthase 1 OS=Streptomyces rimosus PE=3 SV=2 5 427 3.0E-16
sp|Q8L3X9|KASM_ARATH 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Arabidopsis thaliana GN=KAS PE=1 SV=1 151 425 3.0E-16
sp|P22367|MSAS_PENPA 6-methylsalicylic acid synthase OS=Penicillium patulum PE=1 SV=1 1951 2157 4.0E-16
sp|P57193|FABB_BUCAI 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=fabB PE=3 SV=1 158 427 1.0E-15
sp|P19096|FAS_MOUSE Fatty acid synthase OS=Mus musculus GN=Fasn PE=1 SV=2 1721 2139 2.0E-15
sp|P12785|FAS_RAT Fatty acid synthase OS=Rattus norvegicus GN=Fasn PE=1 SV=3 1721 2139 3.0E-15
sp|P73283|FABF_SYNY3 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabF PE=1 SV=1 69 420 5.0E-15
sp|P9WQD7|FAB2_MYCTU 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=kasB PE=1 SV=1 93 423 5.0E-15
sp|P9WQD6|FAB2_MYCTO 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=kasB PE=3 SV=1 93 423 5.0E-15
sp|P63457|FAB2_MYCBO 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=kasB PE=3 SV=1 93 423 5.0E-15
sp|O34340|FABF_BACSU 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Bacillus subtilis (strain 168) GN=fabF PE=1 SV=1 173 425 5.0E-15
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 1934 2155 1.0E-14
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 1955 2292 1.0E-14
sp|P41175|KAS1_STRCM Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces cinnamonensis PE=3 SV=1 166 428 4.0E-14
sp|O69473|FAB2_MYCLE 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Mycobacterium leprae (strain TN) GN=kasB PE=3 SV=2 93 423 6.0E-14
sp|Q9R9J2|FENF_BACIU Malonyl CoA-acyl carrier protein transacylase OS=Bacillus subtilis GN=fenF PE=1 SV=1 549 830 6.0E-14
sp|Q5TKS0|FABF_STAAU 3-oxoacyl-[acyl-carrier-protein] synthase 2 (Fragment) OS=Staphylococcus aureus GN=fabF PE=3 SV=1 157 425 1.0E-13
sp|O34877|PKSD_BACSU Polyketide biosynthesis acyltransferase homolog PksD OS=Bacillus subtilis (strain 168) GN=pksD PE=1 SV=2 551 782 2.0E-13
sp|Q8NXE1|FABF_STAAW 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain MW2) GN=fabF PE=1 SV=1 166 425 2.0E-13
sp|Q6GAU2|FABF_STAAS 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain MSSA476) GN=fabF PE=3 SV=1 166 425 2.0E-13
sp|Q5HHA1|FABF_STAAC 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain COL) GN=fabF PE=1 SV=1 166 425 2.0E-13
sp|Q6GIA3|FABF_STAAR 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain MRSA252) GN=fabF PE=3 SV=1 166 425 2.0E-13
sp|Q7A6F8|FABF_STAAN 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain N315) GN=fabF PE=1 SV=1 166 425 3.0E-13
sp|Q99VA6|FABF_STAAM 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=fabF PE=3 SV=1 166 425 3.0E-13
sp|A7Z4Y0|BAEE_BACMF Polyketide biosynthesis protein BaeE OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=baeE PE=1 SV=1 549 787 3.0E-13
sp|P71019|FABD_BACSU Malonyl CoA-acyl carrier protein transacylase OS=Bacillus subtilis (strain 168) GN=fabD PE=3 SV=2 547 848 4.0E-13
sp|P43710|FABB_HAEIN 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fabB PE=3 SV=1 102 430 6.0E-13
sp|A7Z4X9|BAED_BACMF Polyketide biosynthesis acyltransferase homolog BaeD OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=baeD PE=1 SV=1 549 830 7.0E-13
sp|P0C842|CJ052_HUMAN Putative uncharacterized protein encoded by LINC00614 OS=Homo sapiens GN=LINC00614 PE=5 SV=1 30 141 8.0E-13
sp|Q89AY4|FABB_BUCBP 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=fabB PE=3 SV=1 158 427 1.0E-12
sp|Q02K94|FABB_PSEAB 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=fabB PE=1 SV=1 162 425 2.0E-12
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 1968 2136 5.0E-12
sp|Q8KA28|FABB_BUCAP 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=fabB PE=3 SV=1 158 427 7.0E-12
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 1937 2318 1.0E-11
sp|P9WQE6|PPSA_MYCTO Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsA PE=3 SV=1 1997 2323 2.0E-11
sp|Q7TXM0|PPSA_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsA PE=1 SV=1 1997 2323 2.0E-11
sp|P9WQE7|PPSA_MYCTU Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsA PE=1 SV=1 1997 2323 2.0E-11
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 1923 2145 8.0E-11
sp|P40804|PKSF_BACSU Polyketide biosynthesis malonyl-ACP decarboxylase PksF OS=Bacillus subtilis (strain 168) GN=pksF PE=1 SV=3 176 425 1.0E-10
sp|Q7A124|FABD_STAAW Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain MW2) GN=fabD PE=3 SV=1 547 830 3.0E-10
sp|Q7A5Z3|FABD_STAAN Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain N315) GN=fabD PE=1 SV=1 547 830 3.0E-10
sp|Q99UN8|FABD_STAAM Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=fabD PE=1 SV=1 547 830 3.0E-10
sp|Q93QD4|FABD_STAAU Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus GN=fabD PE=3 SV=1 547 830 3.0E-10
sp|Q5HGK3|FABD_STAAC Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain COL) GN=fabD PE=3 SV=1 547 830 3.0E-10
sp|Q6GHK5|FABD_STAAR Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain MRSA252) GN=fabD PE=3 SV=1 547 830 5.0E-10
sp|Q6G9Y3|FABD_STAAS Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain MSSA476) GN=fabD PE=3 SV=1 547 830 7.0E-10
sp|Q9CBS7|FAB1_MYCLE 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium leprae (strain TN) GN=kasA PE=3 SV=1 169 420 4.0E-09
sp|P9WQD9|FAB1_MYCTU 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=kasA PE=1 SV=1 169 420 1.0E-08
sp|P9WQD8|FAB1_MYCTO 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=kasA PE=3 SV=1 169 420 1.0E-08
sp|H8ESN0|FAB1_MYCTE 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman) GN=kasA PE=2 SV=2 169 420 1.0E-08
sp|P63455|FAB1_MYCBO 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=kasA PE=3 SV=1 169 420 1.0E-08
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 1972 2136 8.0E-08
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 1972 2136 8.0E-08
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 1955 2323 1.0E-07
sp|A7Z4X8|BAEC_BACMF Polyketide biosynthesis malonyl CoA-acyl carrier protein transacylase BaeC OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=baeC PE=1 SV=1 549 789 3.0E-07
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 1955 2193 1.0E-06
sp|P16539|KAS2_STRGA Tetracenomycin C polyketide putative beta-ketoacyl synthase 2 OS=Streptomyces glaucescens GN=tcmL PE=3 SV=2 5 388 1.0E-06
sp|P28304|QOR1_ECOLI Quinone oxidoreductase 1 OS=Escherichia coli (strain K12) GN=qorA PE=1 SV=1 1632 1844 2.0E-06
sp|O34787|PKSE_BACSU Polyketide biosynthesis protein PksE OS=Bacillus subtilis (strain 168) GN=pksE PE=1 SV=3 549 758 3.0E-06
sp|Q7TXL9|PPSB_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsB PE=1 SV=1 1934 2129 5.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

Gene cluster ID Type of secondary metabolism gene
Cluster 16 PKS

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|201
Ophiocordyceps australis 1348a (Ghana) OphauG2|7422
Ophiocordyceps australis 1348a (Ghana) OphauG2|7411
Ophiocordyceps australis 1348a (Ghana) OphauG2|6241
Ophiocordyceps australis 1348a (Ghana) OphauG2|4898
Ophiocordyceps australis 1348a (Ghana) OphauG2|4897
Ophiocordyceps australis 1348a (Ghana) OphauG2|2708
Ophiocordyceps australis 1348a (Ghana) OphauG2|2128
Ophiocordyceps australis 1348a (Ghana) OphauG2|1191
Ophiocordyceps australis 1348a (Ghana) OphauG2|1124
Ophiocordyceps australis 1348a (Ghana) OphauG2|7710
Ophiocordyceps australis map64 (Brazil) OphauB2|4459
Ophiocordyceps australis map64 (Brazil) OphauB2|5387
Ophiocordyceps australis map64 (Brazil) OphauB2|476
Ophiocordyceps australis map64 (Brazil) OphauB2|5635
Ophiocordyceps australis map64 (Brazil) OphauB2|3063 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|5406
Ophiocordyceps australis map64 (Brazil) OphauB2|3017
Ophiocordyceps australis map64 (Brazil) OphauB2|712
Ophiocordyceps australis map64 (Brazil) OphauB2|1455
Ophiocordyceps australis map64 (Brazil) OphauB2|1454
Ophiocordyceps australis map64 (Brazil) OphauB2|6068
Ophiocordyceps australis map64 (Brazil) OphauB2|6715
Ophiocordyceps australis map64 (Brazil) OphauB2|5636
Ophiocordyceps australis map64 (Brazil) OphauB2|7340
Ophiocordyceps australis map64 (Brazil) OphauB2|7710
Ophiocordyceps australis map64 (Brazil) OphauB2|2028
Ophiocordyceps australis map64 (Brazil) OphauB2|5805
Ophiocordyceps camponoti-floridani Ophcf2|02942
Ophiocordyceps subramaniannii Hirsu2|8482
Ophiocordyceps subramaniannii Hirsu2|8480
Ophiocordyceps subramaniannii Hirsu2|7800
Ophiocordyceps subramaniannii Hirsu2|7724
Ophiocordyceps subramaniannii Hirsu2|6729
Ophiocordyceps subramaniannii Hirsu2|5683
Ophiocordyceps subramaniannii Hirsu2|5301
Ophiocordyceps subramaniannii Hirsu2|5151
Ophiocordyceps subramaniannii Hirsu2|4977
Ophiocordyceps subramaniannii Hirsu2|4297
Ophiocordyceps subramaniannii Hirsu2|4296
Ophiocordyceps subramaniannii Hirsu2|3325
Ophiocordyceps subramaniannii Hirsu2|26
Ophiocordyceps subramaniannii Hirsu2|25
Ophiocordyceps subramaniannii Hirsu2|9187
Ophiocordyceps subramaniannii Hirsu2|11188

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3063
MKEDIAVVGIGLRFPGEATSPSELWKVLAQGQSQWSEFPADRLNIDGYFHPGGDRQGSISFRGAHFLKGDVAAFD
SPFFSIAAEDAKAIDPQQRMLLEVSYEALENAGIRKEDVDGSDTSVYVGSFVKDYEQICLRDPDWQPQYAATGNG
IAIMANRISHFFNLHGPSMTLDTGCSGSLVAVHLAAQSLQSGESSLAIAAGSGMILTPNTIMPMTALNFLSPDGR
CFTFDSRANGYGRGEGIGVVVMKRLSDALRDNDSIRAVIRATAVNQDGRTPGITLPSKEAQVANIRAVYAAAKLE
FGETGYVECHGTGTQAGDWRELKAISETLGSVRSVDQPIVVGSIKPNIGHLEGAAGVAGLIKGVLVLEHGQIPPN
INYKEPNPSIDFEGWRVKVPQSLMEWPQEGTRRVSVNCFGFGGTNAHVIMDEAAGYLLAKKVSGHDGSVESKVNG
SKEVESKEVATAPQLLCYSAHEKSGVVRVMEAHVGHLRGLDDCSDEYLRDYAYTLNCRRSRLEWKSFVVASSVDE
VARRVADMGPEAIVRSSGSNRARIGFVFCGQGAQWAQMGKDLFGYGVFSRSVIEASAYMSGELEAPFSLVRELSR
PEGQSLMDEAHIAQAATTVVQMALVDLLASVGIGPRAVVGHSSGEIAAAYAAGALSRKQAWETAYYRGLAASRVS
GLQGAMLVVGLGVEEARELAEAWAGQVQVACINSPRSTTLSGQGQAIGEVEQALRTRGVFCRMLNVGVAYHSQHM
KGVEEEYRGALLGNSPRAASAVMVSSVTGQVIDGRQLHAGYWARNMVSPVDYVAAVEAMMRLAPEERPSLLIELS
PRAALRSPTRDTIEAMDGVVMPDYLSILAPKTPGPASLLRLLGRLWTLGLDVRLDGLLDSEACRPPKCLTDLPAY
GWNHDKTYWHESHLSLANRFRRFGRQDLIGAPTADSTALDRRWRGFLRVAENPWMQDHEVQKTMVYPAAGMVAMV
LEAARQMAADLPADLPAIEGYQVADLAILRALIVPKTSHGLEVALNVKTHSSTAGRFAIYSKSLGRDWEHNASGR
LVLRAASRGQTASFAALDAEHQRLDRLCRQDISPRQLYEVLDTLGISYGPLFQNMTALRRAAAGACVGSVRIPDT
RAKMPAQFEYEHVVHPATLDAMLQTLFAIDASPMVPTFIKSIYVSANASQPGPDVFSGFAKATPTGIGHATASIA
MARLGARVVVDGLHLARLDTASFLPNHRNLCSHIVWKHDAAQVTAATFAQQMELMAHKWPALTVLQLGGGAAATA
AALKALCPDAALTPRLARYTLLDVGAEPAATALDLVKHSPLEPFFQVKQTLAELSAQYHVIIYFVDAQPKVAVAE
LHKHLLPQGILLAQDASLSRQQQEPLDKVLTLDHQPASEPLALMTAQHKPPAAGASQTPIVVLVPPRAERQVAVF
VGDLERAARKTHATLSLATLSSAKVRQDPSLLQGKVVLSLLDVVAPKRCLFHWTQDDFDLFGLVHRAAKTLVWLT
QGAHMTPVKPEAAPMVALARTLMSEDPLKTIVCLDLAPASRLSRCAAAVWAVVEASLAARDDSAPRETEFAELDG
KLLVPRLTTLAPLNRLMLDDWAVTQQRFGSNTSTLHLSIAKPGVADALCYFAEAPMADLGPDEIQVAFERALLCH
LDADTVAGRTTTSSLGIDVVGSVVRVGGGVSCLKPGDRVAALAVGGTVANLVRTDARLASTRCPDTMRSTYLAAV
YALVHMGRAAPRRRVLIQAAASAYGHAALDVAQALDADVYASVFGPQVAQQRAALLACGLEPHRIMDADADSLVD
ALRAATNGHGVDLVYNPTQSHVQAGIDCLRSCGTAFQFAARTPAPAPPPALPPCATLVNFDLPELLRHDVPFVAR
LLADTDRLMLDKHLPSSTLDPLNTPDFALDSLNRALRHLDHSPYLGYACLTATHPDVEVPVLNKKLTKPLHQALD
PAATYLLAGGLGGLGRSISELLISHGVKHLAYVSRSGASSTKAAAFIAALVQRGINARAYSVDLCNHKLLTDTIR
GPMAAEMPAIKGVFQCAAVIKDAVFDNMTFADWNTAVQPKTLGTHNLVQALPADNDAFFVFLASSAAVIGSRGQA
NYAAGNCFLDALAHKLRLEGRRAVSIDLGPVLGAGMLAEDENILTILRASGFYAIRHQDFIKVVSHAITMEAAPG
IDMPPQVALGVGTGGLMRQNNPADPYWSRTALYQYLNLVDMPAPDLSVSDSVAGSATMDLKTMLACCTDKASAAD
IIQAGLVNMLAKAMTMLPEELDPNKPPNAYGVDSLVAVGVRNFVINTFAVQVSVFEVLSDTTIAELSSSIADKGG
YGSHAESV*
Coding >OphauB2|3063
ATGAAAGAGGACATTGCCGTGGTGGGCATCGGCCTACGATTCCCTGGCGAAGCAACATCACCTTCGGAGCTATGG
AAAGTTCTCGCTCAAGGCCAGTCTCAATGGTCCGAGTTTCCAGCAGATCGGCTCAACATTGATGGGTACTTCCAC
CCAGGGGGTGATAGGCAGGGAAGCATCTCGTTTCGCGGGGCGCACTTCCTCAAGGGCGACGTTGCAGCCTTTGAT
TCGCCCTTTTTTTCAATTGCAGCAGAGGACGCCAAAGCAATTGATCCGCAGCAGAGGATGCTCCTCGAGGTGTCG
TACGAGGCACTTGAAAATGCGGGAATCAGGAAAGAAGACGTTGACGGCAGCGACACATCAGTCTACGTGGGGTCT
TTTGTCAAGGACTATGAACAGATTTGTCTGCGCGACCCAGACTGGCAGCCTCAATATGCTGCCACGGGCAATGGC
ATTGCCATCATGGCAAACCGCATCTCGCACTTTTTCAACCTGCACGGCCCCAGCATGACGCTCGACACTGGGTGC
AGCGGCAGTCTGGTGGCGGTCCACTTGGCTGCTCAGAGCCTGCAGAGCGGCGAGTCGTCGCTGGCCATTGCGGCG
GGGTCGGGCATGATTCTCACGCCAAACACAATCATGCCCATGACGGCACTCAACTTTCTCAGCCCCGACGGACGC
TGCTTTACCTTTGACTCGCGAGCAAACGGCTACGGGCGCGGCGAGGGCATCGGGGTGGTGGTGATGAAGCGGCTG
TCGGATGCGCTCCGAGACAACGATAGCATCCGAGCAGTGATTCGGGCCACGGCGGTCAACCAGGACGGACGGACG
CCGGGCATCACGCTGCCGAGTAAGGAAGCGCAGGTGGCGAATATCCGGGCCGTGTACGCGGCGGCAAAGCTCGAG
TTTGGGGAGACGGGATATGTCGAGTGCCACGGGACGGGCACGCAGGCGGGAGACTGGCGGGAACTCAAGGCGATA
TCGGAGACGCTGGGCTCGGTGCGCAGCGTGGATCAGCCCATTGTAGTTGGGTCCATCAAGCCCAACATTGGGCAC
CTCGAGGGCGCAGCGGGAGTGGCGGGCCTCATCAAGGGCGTCTTGGTGCTGGAACATGGACAGATCCCGCCCAAC
ATCAACTACAAGGAGCCCAACCCCAGCATTGACTTTGAGGGCTGGCGCGTCAAGGTGCCGCAGTCGCTGATGGAG
TGGCCGCAAGAGGGCACGCGGCGTGTCAGCGTCAACTGCTTTGGCTTTGGCGGGACGAATGCGCACGTCATCATG
GACGAGGCGGCGGGGTACCTCTTGGCCAAGAAGGTGTCTGGGCACGACGGCTCGGTGGAGAGCAAGGTGAACGGC
AGCAAGGAGGTGGAGAGCAAGGAGGTGGCGACGGCGCCGCAGCTGCTGTGCTACTCGGCGCACGAAAAGAGCGGC
GTGGTGCGCGTCATGGAGGCGCATGTGGGCCATCTCAGGGGGCTAGACGACTGCTCCGACGAGTACCTGCGCGAC
TATGCCTACACGCTCAACTGCCGGCGGTCGAGGCTGGAATGGAAGAGCTTCGTGGTGGCGTCGTCGGTGGACGAG
GTGGCGCGGCGAGTGGCCGACATGGGGCCCGAGGCGATTGTGAGGTCGTCGGGCAGCAACAGGGCGCGCATCGGC
TTCGTCTTTTGCGGGCAGGGGGCGCAGTGGGCGCAGATGGGCAAGGACCTGTTTGGCTACGGCGTCTTCTCGCGC
TCCGTCATTGAGGCGAGCGCGTACATGTCGGGGGAGCTGGAGGCGCCCTTTAGCCTGGTGCGGGAGCTGTCGCGG
CCCGAGGGGCAGTCGCTCATGGACGAGGCGCACATTGCGCAGGCGGCAACGACGGTGGTGCAAATGGCGCTGGTG
GACCTGCTGGCGTCGGTGGGCATTGGGCCGCGGGCCGTGGTGGGCCATTCGTCTGGAGAGATTGCCGCGGCGTAT
GCGGCGGGGGCTCTGAGCCGCAAGCAGGCGTGGGAGACGGCCTACTACCGCGGGCTGGCAGCGTCGAGGGTGTCG
GGGCTCCAGGGCGCCATGCTCGTGGTTGGGCTGGGTGTGGAGGAGGCGCGAGAGCTGGCCGAGGCATGGGCGGGC
CAAGTGCAGGTGGCGTGCATCAACAGCCCGCGGTCCACGACACTGTCGGGCCAGGGCCAGGCCATTGGCGAGGTG
GAGCAGGCGCTGCGGACCAGGGGCGTCTTTTGCCGGATGCTCAATGTGGGCGTGGCCTACCACTCGCAGCACATG
AAGGGGGTGGAGGAGGAGTATCGAGGCGCGCTGCTGGGCAACTCGCCGCGGGCCGCCTCGGCTGTCATGGTGTCG
TCGGTGACGGGCCAGGTCATTGACGGCAGGCAGCTGCATGCGGGCTACTGGGCACGCAATATGGTGTCGCCCGTT
GACTATGTGGCGGCTGTCGAGGCCATGATGAGGCTGGCACCCGAGGAGCGGCCGTCGCTGCTCATTGAGCTGAGC
CCCCGCGCCGCGTTGCGCTCGCCCACGCGGGACACGATTGAGGCCATGGACGGCGTGGTCATGCCCGACTATCTG
TCCATTCTGGCGCCCAAGACGCCGGGCCCGGCCAGCCTGCTGCGGTTGCTGGGTCGGCTGTGGACGCTGGGCCTC
GACGTGCGCCTCGACGGCCTGCTGGACTCGGAGGCGTGCCGGCCGCCCAAGTGCCTGACGGACCTGCCGGCGTAT
GGATGGAACCACGACAAGACTTACTGGCACGAGTCGCACCTCAGCCTGGCCAACCGCTTCCGCCGCTTTGGCCGC
CAGGACCTGATTGGCGCCCCGACGGCCGACTCGACGGCGCTGGATCGGCGGTGGCGCGGCTTTTTGCGCGTGGCC
GAGAACCCCTGGATGCAGGACCACGAGGTGCAAAAGACCATGGTGTACCCGGCGGCCGGCATGGTGGCCATGGTG
CTCGAGGCGGCGCGGCAAATGGCTGCCGACTTGCCTGCCGACTTGCCTGCCATCGAGGGCTACCAGGTGGCCGAC
TTGGCCATATTGCGCGCCCTGATTGTGCCCAAGACGAGCCACGGGCTCGAGGTGGCGCTCAATGTCAAGACGCAC
AGCTCCACGGCCGGCCGCTTTGCCATTTACTCCAAGTCCCTGGGCCGCGACTGGGAGCACAATGCCTCGGGCCGC
CTCGTCTTGCGCGCTGCCTCGCGCGGCCAGACTGCCAGCTTTGCCGCCCTCGACGCCGAGCACCAGCGCCTGGAC
CGACTCTGCCGCCAAGACATCAGCCCGCGCCAGCTATACGAGGTGCTCGACACGCTGGGCATCAGCTACGGGCCC
CTCTTCCAAAACATGACGGCCCTTCGCAGGGCGGCGGCGGGCGCCTGTGTCGGCAGCGTGCGCATCCCCGACACG
CGGGCCAAGATGCCGGCCCAGTTTGAATATGAGCACGTGGTGCACCCGGCCACGCTCGACGCCATGCTGCAGACC
CTCTTCGCCATTGACGCGTCGCCCATGGTGCCCACCTTTATCAAGAGCATCTACGTGTCGGCCAATGCCAGCCAG
CCCGGCCCAGACGTCTTTAGCGGCTTTGCCAAGGCGACGCCCACGGGCATTGGCCATGCCACGGCCTCGATTGCC
ATGGCGCGTCTGGGCGCCCGTGTCGTGGTTGACGGCCTGCACCTGGCGCGGCTCGACACGGCCTCGTTTCTGCCC
AACCACCGCAACCTGTGCTCCCATATTGTCTGGAAGCACGACGCCGCCCAAGTCACGGCCGCCACGTTTGCCCAG
CAAATGGAGCTCATGGCCCACAAGTGGCCCGCCCTGACGGTGCTGCAGCTGGGCGGCGGCGCTGCTGCCACGGCC
GCCGCCCTCAAGGCCCTGTGTCCCGACGCCGCCCTGACGCCGCGCCTGGCCCGCTACACCCTGCTCGACGTTGGC
GCCGAGCCGGCCGCCACGGCCCTGGACTTGGTCAAGCACTCGCCCCTGGAGCCCTTTTTCCAAGTCAAGCAGACG
CTCGCCGAGCTCTCGGCCCAGTACCATGTCATTATCTACTTTGTCGACGCCCAGCCCAAGGTGGCCGTGGCAGAG
CTGCACAAGCACCTCTTGCCACAGGGCATATTGCTGGCCCAAGACGCCTCGCTGTCCCGGCAGCAGCAAGAACCG
CTCGACAAGGTGCTGACGCTAGACCACCAGCCGGCCTCGGAGCCCCTGGCGCTCATGACGGCCCAGCACAAGCCG
CCGGCCGCCGGCGCCTCCCAGACGCCCATTGTCGTGCTCGTGCCGCCACGCGCCGAGCGCCAAGTGGCCGTCTTT
GTCGGCGACTTGGAGCGCGCGGCGCGCAAGACGCATGCCACCCTCAGCCTCGCCACGCTGTCGTCGGCCAAGGTG
CGCCAGGACCCCAGCCTGCTCCAGGGCAAGGTGGTGCTGTCTCTGCTCGACGTGGTGGCCCCCAAGCGCTGCCTC
TTCCACTGGACCCAAGACGACTTTGATCTCTTTGGCCTGGTGCACAGGGCGGCCAAGACGCTCGTGTGGCTGACG
CAGGGCGCCCACATGACGCCCGTCAAGCCCGAGGCGGCGCCCATGGTGGCCCTGGCGCGCACCCTCATGTCGGAA
GACCCCCTCAAGACGATTGTCTGCCTCGACCTGGCGCCCGCCTCGCGCCTCAGCCGCTGCGCTGCCGCTGTGTGG
GCCGTGGTGGAGGCCTCCCTGGCCGCCCGTGACGACTCGGCGCCGCGCGAGACCGAGTTCGCCGAGCTGGACGGC
AAGCTGCTGGTGCCGCGCCTCACCACGCTGGCGCCCCTCAACCGCCTCATGCTGGACGACTGGGCCGTGACGCAG
CAGCGCTTTGGCAGCAACACGTCGACGCTGCACCTCAGCATTGCCAAGCCCGGCGTGGCAGACGCCCTCTGCTAC
TTTGCCGAGGCGCCCATGGCCGACCTGGGGCCTGACGAGATCCAAGTGGCCTTTGAACGAGCCCTGCTGTGCCAC
CTCGACGCCGACACGGTGGCCGGCCGCACCACGACCTCGTCGCTAGGCATAGACGTGGTGGGCTCCGTGGTGCGC
GTGGGAGGCGGCGTCTCGTGCCTCAAGCCGGGCGATCGCGTCGCTGCCCTGGCCGTGGGCGGCACCGTGGCCAAT
CTGGTGCGCACCGATGCTCGCCTTGCCTCGACGCGTTGCCCCGACACCATGCGCAGCACCTACCTGGCCGCTGTC
TATGCCCTGGTGCACATGGGCCGAGCCGCGCCGCGCCGCCGCGTCCTCATCCAGGCCGCTGCCAGCGCCTATGGC
CACGCCGCCCTCGACGTGGCCCAGGCCCTCGACGCCGACGTCTATGCCTCCGTCTTTGGCCCCCAAGTCGCCCAG
CAGCGCGCCGCCTTGCTGGCCTGCGGCCTCGAGCCCCATCGCATCATGGACGCCGATGCCGACAGCCTCGTCGAT
GCCCTGCGCGCCGCCACCAACGGCCACGGCGTCGACCTGGTCTACAATCCCACCCAGTCCCATGTCCAGGCCGGC
ATCGACTGTCTGCGCTCCTGCGGCACCGCTTTTCAATTTGCCGCCCGCACCCCCGCCCCCGCGCCCCCCCCCGCC
CTCCCCCCTTGTGCCACCCTCGTCAACTTTGACTTGCCCGAGCTGTTGCGCCACGACGTGCCCTTTGTCGCCCGC
CTGCTTGCCGACACGGACCGCCTCATGCTCGACAAGCACTTGCCCTCCTCCACCCTCGACCCTCTCAACACGCCC
GACTTTGCCCTTGACAGCCTCAACCGCGCCCTGCGCCATCTTGACCACTCCCCCTACCTCGGATACGCCTGCCTC
ACCGCCACCCACCCCGACGTCGAGGTGCCCGTCCTCAACAAGAAGCTCACCAAGCCCTTGCACCAGGCTCTGGAT
CCCGCTGCCACCTACCTCCTTGCCGGAGGCCTCGGCGGTCTTGGCCGCAGCATCTCGGAGTTGCTCATCTCCCAC
GGCGTCAAACACTTGGCCTATGTCTCCCGCTCTGGCGCCTCCTCGACCAAGGCCGCCGCCTTTATTGCCGCTCTC
GTCCAGCGTGGCATCAATGCCCGCGCCTACTCGGTCGACTTGTGCAACCACAAACTCCTCACAGACACCATTCGC
GGCCCCATGGCGGCCGAGATGCCTGCCATCAAGGGCGTCTTCCAGTGCGCTGCCGTTATCAAGGACGCCGTCTTT
GACAACATGACTTTTGCCGATTGGAACACGGCCGTCCAGCCCAAGACGCTCGGCACCCACAACTTGGTCCAGGCC
CTCCCCGCCGACAATGATGCATTCTTTGTCTTTCTCGCCAGTTCGGCCGCCGTCATTGGCAGCCGAGGCCAGGCA
AACTATGCCGCCGGCAACTGCTTCCTCGACGCCCTGGCCCACAAGCTTCGTCTTGAGGGCCGTCGCGCCGTCTCC
ATTGATCTCGGCCCAGTCCTCGGCGCCGGTATGCTGGCCGAAGACGAGAACATTCTCACTATTCTGCGCGCCAGC
GGCTTCTATGCCATACGCCACCAAGACTTCATCAAGGTCGTCAGCCATGCCATCACCATGGAGGCCGCTCCCGGC
ATCGACATGCCCCCCCAGGTTGCCCTTGGAGTCGGCACTGGTGGTCTCATGCGCCAAAACAACCCTGCCGACCCC
TACTGGTCCCGCACCGCCTTGTACCAATACCTCAACCTCGTTGACATGCCTGCTCCCGACCTGTCCGTCTCCGAC
TCTGTCGCTGGCTCTGCCACCATGGATCTCAAGACCATGCTAGCCTGCTGCACCGACAAGGCGTCGGCCGCCGAC
ATTATCCAGGCCGGCCTTGTCAATATGCTGGCCAAGGCCATGACCATGCTCCCCGAGGAGCTGGACCCCAACAAG
CCACCCAATGCCTATGGCGTCGATTCGCTTGTTGCCGTCGGTGTTCGCAACTTTGTTATAAACACCTTTGCCGTC
CAGGTGTCCGTATTTGAGGTGCTCAGTGACACCACCATTGCCGAGCTGTCAAGCTCCATTGCCGACAAAGGAGGC
TATGGCAGTCATGCTGAAAGCGTCTAA
Transcript >OphauB2|3063
ATGAAAGAGGACATTGCCGTGGTGGGCATCGGCCTACGATTCCCTGGCGAAGCAACATCACCTTCGGAGCTATGG
AAAGTTCTCGCTCAAGGCCAGTCTCAATGGTCCGAGTTTCCAGCAGATCGGCTCAACATTGATGGGTACTTCCAC
CCAGGGGGTGATAGGCAGGGAAGCATCTCGTTTCGCGGGGCGCACTTCCTCAAGGGCGACGTTGCAGCCTTTGAT
TCGCCCTTTTTTTCAATTGCAGCAGAGGACGCCAAAGCAATTGATCCGCAGCAGAGGATGCTCCTCGAGGTGTCG
TACGAGGCACTTGAAAATGCGGGAATCAGGAAAGAAGACGTTGACGGCAGCGACACATCAGTCTACGTGGGGTCT
TTTGTCAAGGACTATGAACAGATTTGTCTGCGCGACCCAGACTGGCAGCCTCAATATGCTGCCACGGGCAATGGC
ATTGCCATCATGGCAAACCGCATCTCGCACTTTTTCAACCTGCACGGCCCCAGCATGACGCTCGACACTGGGTGC
AGCGGCAGTCTGGTGGCGGTCCACTTGGCTGCTCAGAGCCTGCAGAGCGGCGAGTCGTCGCTGGCCATTGCGGCG
GGGTCGGGCATGATTCTCACGCCAAACACAATCATGCCCATGACGGCACTCAACTTTCTCAGCCCCGACGGACGC
TGCTTTACCTTTGACTCGCGAGCAAACGGCTACGGGCGCGGCGAGGGCATCGGGGTGGTGGTGATGAAGCGGCTG
TCGGATGCGCTCCGAGACAACGATAGCATCCGAGCAGTGATTCGGGCCACGGCGGTCAACCAGGACGGACGGACG
CCGGGCATCACGCTGCCGAGTAAGGAAGCGCAGGTGGCGAATATCCGGGCCGTGTACGCGGCGGCAAAGCTCGAG
TTTGGGGAGACGGGATATGTCGAGTGCCACGGGACGGGCACGCAGGCGGGAGACTGGCGGGAACTCAAGGCGATA
TCGGAGACGCTGGGCTCGGTGCGCAGCGTGGATCAGCCCATTGTAGTTGGGTCCATCAAGCCCAACATTGGGCAC
CTCGAGGGCGCAGCGGGAGTGGCGGGCCTCATCAAGGGCGTCTTGGTGCTGGAACATGGACAGATCCCGCCCAAC
ATCAACTACAAGGAGCCCAACCCCAGCATTGACTTTGAGGGCTGGCGCGTCAAGGTGCCGCAGTCGCTGATGGAG
TGGCCGCAAGAGGGCACGCGGCGTGTCAGCGTCAACTGCTTTGGCTTTGGCGGGACGAATGCGCACGTCATCATG
GACGAGGCGGCGGGGTACCTCTTGGCCAAGAAGGTGTCTGGGCACGACGGCTCGGTGGAGAGCAAGGTGAACGGC
AGCAAGGAGGTGGAGAGCAAGGAGGTGGCGACGGCGCCGCAGCTGCTGTGCTACTCGGCGCACGAAAAGAGCGGC
GTGGTGCGCGTCATGGAGGCGCATGTGGGCCATCTCAGGGGGCTAGACGACTGCTCCGACGAGTACCTGCGCGAC
TATGCCTACACGCTCAACTGCCGGCGGTCGAGGCTGGAATGGAAGAGCTTCGTGGTGGCGTCGTCGGTGGACGAG
GTGGCGCGGCGAGTGGCCGACATGGGGCCCGAGGCGATTGTGAGGTCGTCGGGCAGCAACAGGGCGCGCATCGGC
TTCGTCTTTTGCGGGCAGGGGGCGCAGTGGGCGCAGATGGGCAAGGACCTGTTTGGCTACGGCGTCTTCTCGCGC
TCCGTCATTGAGGCGAGCGCGTACATGTCGGGGGAGCTGGAGGCGCCCTTTAGCCTGGTGCGGGAGCTGTCGCGG
CCCGAGGGGCAGTCGCTCATGGACGAGGCGCACATTGCGCAGGCGGCAACGACGGTGGTGCAAATGGCGCTGGTG
GACCTGCTGGCGTCGGTGGGCATTGGGCCGCGGGCCGTGGTGGGCCATTCGTCTGGAGAGATTGCCGCGGCGTAT
GCGGCGGGGGCTCTGAGCCGCAAGCAGGCGTGGGAGACGGCCTACTACCGCGGGCTGGCAGCGTCGAGGGTGTCG
GGGCTCCAGGGCGCCATGCTCGTGGTTGGGCTGGGTGTGGAGGAGGCGCGAGAGCTGGCCGAGGCATGGGCGGGC
CAAGTGCAGGTGGCGTGCATCAACAGCCCGCGGTCCACGACACTGTCGGGCCAGGGCCAGGCCATTGGCGAGGTG
GAGCAGGCGCTGCGGACCAGGGGCGTCTTTTGCCGGATGCTCAATGTGGGCGTGGCCTACCACTCGCAGCACATG
AAGGGGGTGGAGGAGGAGTATCGAGGCGCGCTGCTGGGCAACTCGCCGCGGGCCGCCTCGGCTGTCATGGTGTCG
TCGGTGACGGGCCAGGTCATTGACGGCAGGCAGCTGCATGCGGGCTACTGGGCACGCAATATGGTGTCGCCCGTT
GACTATGTGGCGGCTGTCGAGGCCATGATGAGGCTGGCACCCGAGGAGCGGCCGTCGCTGCTCATTGAGCTGAGC
CCCCGCGCCGCGTTGCGCTCGCCCACGCGGGACACGATTGAGGCCATGGACGGCGTGGTCATGCCCGACTATCTG
TCCATTCTGGCGCCCAAGACGCCGGGCCCGGCCAGCCTGCTGCGGTTGCTGGGTCGGCTGTGGACGCTGGGCCTC
GACGTGCGCCTCGACGGCCTGCTGGACTCGGAGGCGTGCCGGCCGCCCAAGTGCCTGACGGACCTGCCGGCGTAT
GGATGGAACCACGACAAGACTTACTGGCACGAGTCGCACCTCAGCCTGGCCAACCGCTTCCGCCGCTTTGGCCGC
CAGGACCTGATTGGCGCCCCGACGGCCGACTCGACGGCGCTGGATCGGCGGTGGCGCGGCTTTTTGCGCGTGGCC
GAGAACCCCTGGATGCAGGACCACGAGGTGCAAAAGACCATGGTGTACCCGGCGGCCGGCATGGTGGCCATGGTG
CTCGAGGCGGCGCGGCAAATGGCTGCCGACTTGCCTGCCGACTTGCCTGCCATCGAGGGCTACCAGGTGGCCGAC
TTGGCCATATTGCGCGCCCTGATTGTGCCCAAGACGAGCCACGGGCTCGAGGTGGCGCTCAATGTCAAGACGCAC
AGCTCCACGGCCGGCCGCTTTGCCATTTACTCCAAGTCCCTGGGCCGCGACTGGGAGCACAATGCCTCGGGCCGC
CTCGTCTTGCGCGCTGCCTCGCGCGGCCAGACTGCCAGCTTTGCCGCCCTCGACGCCGAGCACCAGCGCCTGGAC
CGACTCTGCCGCCAAGACATCAGCCCGCGCCAGCTATACGAGGTGCTCGACACGCTGGGCATCAGCTACGGGCCC
CTCTTCCAAAACATGACGGCCCTTCGCAGGGCGGCGGCGGGCGCCTGTGTCGGCAGCGTGCGCATCCCCGACACG
CGGGCCAAGATGCCGGCCCAGTTTGAATATGAGCACGTGGTGCACCCGGCCACGCTCGACGCCATGCTGCAGACC
CTCTTCGCCATTGACGCGTCGCCCATGGTGCCCACCTTTATCAAGAGCATCTACGTGTCGGCCAATGCCAGCCAG
CCCGGCCCAGACGTCTTTAGCGGCTTTGCCAAGGCGACGCCCACGGGCATTGGCCATGCCACGGCCTCGATTGCC
ATGGCGCGTCTGGGCGCCCGTGTCGTGGTTGACGGCCTGCACCTGGCGCGGCTCGACACGGCCTCGTTTCTGCCC
AACCACCGCAACCTGTGCTCCCATATTGTCTGGAAGCACGACGCCGCCCAAGTCACGGCCGCCACGTTTGCCCAG
CAAATGGAGCTCATGGCCCACAAGTGGCCCGCCCTGACGGTGCTGCAGCTGGGCGGCGGCGCTGCTGCCACGGCC
GCCGCCCTCAAGGCCCTGTGTCCCGACGCCGCCCTGACGCCGCGCCTGGCCCGCTACACCCTGCTCGACGTTGGC
GCCGAGCCGGCCGCCACGGCCCTGGACTTGGTCAAGCACTCGCCCCTGGAGCCCTTTTTCCAAGTCAAGCAGACG
CTCGCCGAGCTCTCGGCCCAGTACCATGTCATTATCTACTTTGTCGACGCCCAGCCCAAGGTGGCCGTGGCAGAG
CTGCACAAGCACCTCTTGCCACAGGGCATATTGCTGGCCCAAGACGCCTCGCTGTCCCGGCAGCAGCAAGAACCG
CTCGACAAGGTGCTGACGCTAGACCACCAGCCGGCCTCGGAGCCCCTGGCGCTCATGACGGCCCAGCACAAGCCG
CCGGCCGCCGGCGCCTCCCAGACGCCCATTGTCGTGCTCGTGCCGCCACGCGCCGAGCGCCAAGTGGCCGTCTTT
GTCGGCGACTTGGAGCGCGCGGCGCGCAAGACGCATGCCACCCTCAGCCTCGCCACGCTGTCGTCGGCCAAGGTG
CGCCAGGACCCCAGCCTGCTCCAGGGCAAGGTGGTGCTGTCTCTGCTCGACGTGGTGGCCCCCAAGCGCTGCCTC
TTCCACTGGACCCAAGACGACTTTGATCTCTTTGGCCTGGTGCACAGGGCGGCCAAGACGCTCGTGTGGCTGACG
CAGGGCGCCCACATGACGCCCGTCAAGCCCGAGGCGGCGCCCATGGTGGCCCTGGCGCGCACCCTCATGTCGGAA
GACCCCCTCAAGACGATTGTCTGCCTCGACCTGGCGCCCGCCTCGCGCCTCAGCCGCTGCGCTGCCGCTGTGTGG
GCCGTGGTGGAGGCCTCCCTGGCCGCCCGTGACGACTCGGCGCCGCGCGAGACCGAGTTCGCCGAGCTGGACGGC
AAGCTGCTGGTGCCGCGCCTCACCACGCTGGCGCCCCTCAACCGCCTCATGCTGGACGACTGGGCCGTGACGCAG
CAGCGCTTTGGCAGCAACACGTCGACGCTGCACCTCAGCATTGCCAAGCCCGGCGTGGCAGACGCCCTCTGCTAC
TTTGCCGAGGCGCCCATGGCCGACCTGGGGCCTGACGAGATCCAAGTGGCCTTTGAACGAGCCCTGCTGTGCCAC
CTCGACGCCGACACGGTGGCCGGCCGCACCACGACCTCGTCGCTAGGCATAGACGTGGTGGGCTCCGTGGTGCGC
GTGGGAGGCGGCGTCTCGTGCCTCAAGCCGGGCGATCGCGTCGCTGCCCTGGCCGTGGGCGGCACCGTGGCCAAT
CTGGTGCGCACCGATGCTCGCCTTGCCTCGACGCGTTGCCCCGACACCATGCGCAGCACCTACCTGGCCGCTGTC
TATGCCCTGGTGCACATGGGCCGAGCCGCGCCGCGCCGCCGCGTCCTCATCCAGGCCGCTGCCAGCGCCTATGGC
CACGCCGCCCTCGACGTGGCCCAGGCCCTCGACGCCGACGTCTATGCCTCCGTCTTTGGCCCCCAAGTCGCCCAG
CAGCGCGCCGCCTTGCTGGCCTGCGGCCTCGAGCCCCATCGCATCATGGACGCCGATGCCGACAGCCTCGTCGAT
GCCCTGCGCGCCGCCACCAACGGCCACGGCGTCGACCTGGTCTACAATCCCACCCAGTCCCATGTCCAGGCCGGC
ATCGACTGTCTGCGCTCCTGCGGCACCGCTTTTCAATTTGCCGCCCGCACCCCCGCCCCCGCGCCCCCCCCCGCC
CTCCCCCCTTGTGCCACCCTCGTCAACTTTGACTTGCCCGAGCTGTTGCGCCACGACGTGCCCTTTGTCGCCCGC
CTGCTTGCCGACACGGACCGCCTCATGCTCGACAAGCACTTGCCCTCCTCCACCCTCGACCCTCTCAACACGCCC
GACTTTGCCCTTGACAGCCTCAACCGCGCCCTGCGCCATCTTGACCACTCCCCCTACCTCGGATACGCCTGCCTC
ACCGCCACCCACCCCGACGTCGAGGTGCCCGTCCTCAACAAGAAGCTCACCAAGCCCTTGCACCAGGCTCTGGAT
CCCGCTGCCACCTACCTCCTTGCCGGAGGCCTCGGCGGTCTTGGCCGCAGCATCTCGGAGTTGCTCATCTCCCAC
GGCGTCAAACACTTGGCCTATGTCTCCCGCTCTGGCGCCTCCTCGACCAAGGCCGCCGCCTTTATTGCCGCTCTC
GTCCAGCGTGGCATCAATGCCCGCGCCTACTCGGTCGACTTGTGCAACCACAAACTCCTCACAGACACCATTCGC
GGCCCCATGGCGGCCGAGATGCCTGCCATCAAGGGCGTCTTCCAGTGCGCTGCCGTTATCAAGGACGCCGTCTTT
GACAACATGACTTTTGCCGATTGGAACACGGCCGTCCAGCCCAAGACGCTCGGCACCCACAACTTGGTCCAGGCC
CTCCCCGCCGACAATGATGCATTCTTTGTCTTTCTCGCCAGTTCGGCCGCCGTCATTGGCAGCCGAGGCCAGGCA
AACTATGCCGCCGGCAACTGCTTCCTCGACGCCCTGGCCCACAAGCTTCGTCTTGAGGGCCGTCGCGCCGTCTCC
ATTGATCTCGGCCCAGTCCTCGGCGCCGGTATGCTGGCCGAAGACGAGAACATTCTCACTATTCTGCGCGCCAGC
GGCTTCTATGCCATACGCCACCAAGACTTCATCAAGGTCGTCAGCCATGCCATCACCATGGAGGCCGCTCCCGGC
ATCGACATGCCCCCCCAGGTTGCCCTTGGAGTCGGCACTGGTGGTCTCATGCGCCAAAACAACCCTGCCGACCCC
TACTGGTCCCGCACCGCCTTGTACCAATACCTCAACCTCGTTGACATGCCTGCTCCCGACCTGTCCGTCTCCGAC
TCTGTCGCTGGCTCTGCCACCATGGATCTCAAGACCATGCTAGCCTGCTGCACCGACAAGGCGTCGGCCGCCGAC
ATTATCCAGGCCGGCCTTGTCAATATGCTGGCCAAGGCCATGACCATGCTCCCCGAGGAGCTGGACCCCAACAAG
CCACCCAATGCCTATGGCGTCGATTCGCTTGTTGCCGTCGGTGTTCGCAACTTTGTTATAAACACCTTTGCCGTC
CAGGTGTCCGTATTTGAGGTGCTCAGTGACACCACCATTGCCGAGCTGTCAAGCTCCATTGCCGACAAAGGAGGC
TATGGCAGTCATGCTGAAAGCGTCTAA
Gene >OphauB2|3063
ATGAAAGAGGACATTGCCGTGGTGGGCATCGGCCTACGATTCCCTGGCGAAGCAACATCACCTTCGGAGCTATGG
AAAGTTCTCGCTCAAGGCCAGTCTCAATGGTCCGAGTTTCCAGCAGATCGGCTCAACATTGATGGGTACTTCCAC
CCAGGGGGTGATAGGCAGGGAAGCATCTCGTTTCGCGGGGCGCACTTCCTCAAGGGCGACGTTGCAGCCTTTGAT
TCGCCCTTTTTTTCAATTGCAGCAGAGGACGCCAAAGCAATTGATCCGCAGCAGAGGATGCTCCTCGAGGTGTCG
TACGAGGCACTTGAAAATGCGGGAATCAGGAAAGAAGACGTTGACGGCAGCGACACATCAGTCTACGTGGGGTCT
TTTGTCAAGGACTATGAACAGATTTGTCTGCGCGACCCAGACTGGCAGCCTCAATATGCTGCCACGGGCAATGGC
ATTGCCATCATGGCAAACCGCATCTCGCACTTTTTCAACCTGCACGGCCCCAGCATGACGCTCGACACTGGGTGC
AGCGGCAGTCTGGTGGCGGTCCACTTGGCTGCTCAGAGCCTGCAGAGCGGCGAGTCGTCGCTGGCCATTGCGGCG
GGGTCGGGCATGATTCTCACGCCAAACACAATCATGCCCATGACGGCACTCAACTTTCTCAGCCCCGACGGACGC
TGCTTTACCTTTGACTCGCGAGCAAACGGCTACGGGCGCGGCGAGGGCATCGGGGTGGTGGTGATGAAGCGGCTG
TCGGATGCGCTCCGAGACAACGATAGCATCCGAGCAGTGATTCGGGCCACGGCGGTCAACCAGGACGGACGGACG
CCGGGCATCACGCTGCCGAGTAAGGAAGCGCAGGTGGCGAATATCCGGGCCGTGTACGCGGCGGCAAAGCTCGAG
TTTGGGGAGACGGGATATGTCGAGTGCCACGGGACGGGCACGCAGGCGGGAGACTGGCGGGAACTCAAGGCGATA
TCGGAGACGCTGGGCTCGGTGCGCAGCGTGGATCAGCCCATTGTAGTTGGGTCCATCAAGCCCAACATTGGGCAC
CTCGAGGGCGCAGCGGGAGTGGCGGGCCTCATCAAGGGCGTCTTGGTGCTGGAACATGGACAGATCCCGCCCAAC
ATCAACTACAAGGAGCCCAACCCCAGCATTGACTTTGAGGGCTGGCGCGTCAAGGTGCCGCAGTCGCTGATGGAG
TGGCCGCAAGAGGGCACGCGGCGTGTCAGCGTCAACTGCTTTGGCTTTGGCGGGACGAATGCGCACGTCATCATG
GACGAGGCGGCGGGGTACCTCTTGGCCAAGAAGGTGTCTGGGCACGACGGCTCGGTGGAGAGCAAGGTGAACGGC
AGCAAGGAGGTGGAGAGCAAGGAGGTGGCGACGGCGCCGCAGCTGCTGTGCTACTCGGCGCACGAAAAGAGCGGC
GTGGTGCGCGTCATGGAGGCGCATGTGGGCCATCTCAGGGGGCTAGACGACTGCTCCGACGAGTACCTGCGCGAC
TATGCCTACACGCTCAACTGCCGGCGGTCGAGGCTGGAATGGAAGAGCTTCGTGGTGGCGTCGTCGGTGGACGAG
GTGGCGCGGCGAGTGGCCGACATGGGGCCCGAGGCGATTGTGAGGTCGTCGGGCAGCAACAGGGCGCGCATCGGC
TTCGTCTTTTGCGGGCAGGGGGCGCAGTGGGCGCAGATGGGCAAGGACCTGTTTGGCTACGGCGTCTTCTCGCGC
TCCGTCATTGAGGCGAGCGCGTACATGTCGGGGGAGCTGGAGGCGCCCTTTAGCCTGGTGCGGGAGCTGTCGCGG
CCCGAGGGGCAGTCGCTCATGGACGAGGCGCACATTGCGCAGGCGGCAACGACGGTGGTGCAAATGGCGCTGGTG
GACCTGCTGGCGTCGGTGGGCATTGGGCCGCGGGCCGTGGTGGGCCATTCGTCTGGAGAGATTGCCGCGGCGTAT
GCGGCGGGGGCTCTGAGCCGCAAGCAGGCGTGGGAGACGGCCTACTACCGCGGGCTGGCAGCGTCGAGGGTGTCG
GGGCTCCAGGGCGCCATGCTCGTGGTTGGGCTGGGTGTGGAGGAGGCGCGAGAGCTGGCCGAGGCATGGGCGGGC
CAAGTGCAGGTGGCGTGCATCAACAGCCCGCGGTCCACGACACTGTCGGGCCAGGGCCAGGCCATTGGCGAGGTG
GAGCAGGCGCTGCGGACCAGGGGCGTCTTTTGCCGGATGCTCAATGTGGGCGTGGCCTACCACTCGCAGCACATG
AAGGGGGTGGAGGAGGAGTATCGAGGCGCGCTGCTGGGCAACTCGCCGCGGGCCGCCTCGGCTGTCATGGTGTCG
TCGGTGACGGGCCAGGTCATTGACGGCAGGCAGCTGCATGCGGGCTACTGGGCACGCAATATGGTGTCGCCCGTT
GACTATGTGGCGGCTGTCGAGGCCATGATGAGGCTGGCACCCGAGGAGCGGCCGTCGCTGCTCATTGAGCTGAGC
CCCCGCGCCGCGTTGCGCTCGCCCACGCGGGACACGATTGAGGCCATGGACGGCGTGGTCATGCCCGACTATCTG
TCCATTCTGGCGCCCAAGACGCCGGGCCCGGCCAGCCTGCTGCGGTTGCTGGGTCGGCTGTGGACGCTGGGCCTC
GACGTGCGCCTCGACGGCCTGCTGGACTCGGAGGCGTGCCGGCCGCCCAAGTGCCTGACGGACCTGCCGGCGTAT
GGATGGAACCACGACAAGACTTACTGGCACGAGTCGCACCTCAGCCTGGCCAACCGCTTCCGCCGCTTTGGCCGC
CAGGACCTGATTGGCGCCCCGACGGCCGACTCGACGGCGCTGGATCGGCGGTGGCGCGGCTTTTTGCGCGTGGCC
GAGAACCCCTGGATGCAGGACCACGAGGTGCAAAAGACCATGGTGTACCCGGCGGCCGGCATGGTGGCCATGGTG
CTCGAGGCGGCGCGGCAAATGGCTGCCGACTTGCCTGCCGACTTGCCTGCCATCGAGGGCTACCAGGTGGCCGAC
TTGGCCATATTGCGCGCCCTGATTGTGCCCAAGACGAGCCACGGGCTCGAGGTGGCGCTCAATGTCAAGACGCAC
AGCTCCACGGCCGGCCGCTTTGCCATTTACTCCAAGTCCCTGGGCCGCGACTGGGAGCACAATGCCTCGGGCCGC
CTCGTCTTGCGCGCTGCCTCGCGCGGCCAGACTGCCAGCTTTGCCGCCCTCGACGCCGAGCACCAGCGCCTGGAC
CGACTCTGCCGCCAAGACATCAGCCCGCGCCAGCTATACGAGGTGCTCGACACGCTGGGCATCAGCTACGGGCCC
CTCTTCCAAAACATGACGGCCCTTCGCAGGGCGGCGGCGGGCGCCTGTGTCGGCAGCGTGCGCATCCCCGACACG
CGGGCCAAGATGCCGGCCCAGTTTGAATATGAGCACGTGGTGCACCCGGCCACGCTCGACGCCATGCTGCAGACC
CTCTTCGCCATTGACGCGTCGCCCATGGTGCCCACCTTTATCAAGAGCATCTACGTGTCGGCCAATGCCAGCCAG
CCCGGCCCAGACGTCTTTAGCGGCTTTGCCAAGGCGACGCCCACGGGCATTGGCCATGCCACGGCCTCGATTGCC
ATGGCGCGTCTGGGCGCCCGTGTCGTGGTTGACGGCCTGCACCTGGCGCGGCTCGACACGGCCTCGTTTCTGCCC
AACCACCGCAACCTGTGCTCCCATATTGTCTGGAAGCACGACGCCGCCCAAGTCACGGCCGCCACGTTTGCCCAG
CAAATGGAGCTCATGGCCCACAAGTGGCCCGCCCTGACGGTGCTGCAGCTGGGCGGCGGCGCTGCTGCCACGGCC
GCCGCCCTCAAGGCCCTGTGTCCCGACGCCGCCCTGACGCCGCGCCTGGCCCGCTACACCCTGCTCGACGTTGGC
GCCGAGCCGGCCGCCACGGCCCTGGACTTGGTCAAGCACTCGCCCCTGGAGCCCTTTTTCCAAGTCAAGCAGACG
CTCGCCGAGCTCTCGGCCCAGTACCATGTCATTATCTACTTTGTCGACGCCCAGCCCAAGGTGGCCGTGGCAGAG
CTGCACAAGCACCTCTTGCCACAGGGCATATTGCTGGCCCAAGACGCCTCGCTGTCCCGGCAGCAGCAAGAACCG
CTCGACAAGGTGCTGACGCTAGACCACCAGCCGGCCTCGGAGCCCCTGGCGCTCATGACGGCCCAGCACAAGCCG
CCGGCCGCCGGCGCCTCCCAGACGCCCATTGTCGTGCTCGTGCCGCCACGCGCCGAGCGCCAAGTGGCCGTCTTT
GTCGGCGACTTGGAGCGCGCGGCGCGCAAGACGCATGCCACCCTCAGCCTCGCCACGCTGTCGTCGGCCAAGGTG
CGCCAGGACCCCAGCCTGCTCCAGGGCAAGGTGGTGCTGTCTCTGCTCGACGTGGTGGCCCCCAAGCGCTGCCTC
TTCCACTGGACCCAAGACGACTTTGATCTCTTTGGCCTGGTGCACAGGGCGGCCAAGACGCTCGTGTGGCTGACG
CAGGGCGCCCACATGACGCCCGTCAAGCCCGAGGCGGCGCCCATGGTGGCCCTGGCGCGCACCCTCATGTCGGAA
GACCCCCTCAAGACGATTGTCTGCCTCGACCTGGCGCCCGCCTCGCGCCTCAGCCGCTGCGCTGCCGCTGTGTGG
GCCGTGGTGGAGGCCTCCCTGGCCGCCCGTGACGACTCGGCGCCGCGCGAGACCGAGTTCGCCGAGCTGGACGGC
AAGCTGCTGGTGCCGCGCCTCACCACGCTGGCGCCCCTCAACCGCCTCATGCTGGACGACTGGGCCGTGACGCAG
CAGCGCTTTGGCAGCAACACGTCGACGCTGCACCTCAGCATTGCCAAGCCCGGCGTGGCAGACGCCCTCTGCTAC
TTTGCCGAGGCGCCCATGGCCGACCTGGGGCCTGACGAGATCCAAGTGGCCTTTGAACGAGCCCTGCTGTGCCAC
CTCGACGCCGACACGGTGGCCGGCCGCACCACGACCTCGTCGCTAGGCATAGACGTGGTGGGCTCCGTGGTGCGC
GTGGGAGGCGGCGTCTCGTGCCTCAAGCCGGGCGATCGCGTCGCTGCCCTGGCCGTGGGCGGCACCGTGGCCAAT
CTGGTGCGCACCGATGCTCGCCTTGCCTCGACGCGTTGCCCCGACACCATGCGCAGCACCTACCTGGCCGCTGTC
TATGCCCTGGTGCACATGGGCCGAGCCGCGCCGCGCCGCCGCGTCCTCATCCAGGCCGCTGCCAGCGCCTATGGC
CACGCCGCCCTCGACGTGGCCCAGGCCCTCGACGCCGACGTCTATGCCTCCGTCTTTGGCCCCCAAGTCGCCCAG
CAGCGCGCCGCCTTGCTGGCCTGCGGCCTCGAGCCCCATCGCATCATGGACGCCGATGCCGACAGCCTCGTCGAT
GCCCTGCGCGCCGCCACCAACGGCCACGGCGTCGACCTGGTCTACAATCCCACCCAGTCCCATGTCCAGGCCGGC
ATCGACTGTCTGCGCTCCTGCGGCACCGCTTTTCAATTTGCCGCCCGCACCCCCGCCCCCGCGCCCCCCCCCGCC
CTCCCCCCTTGTGCCACCCTCGTCAACTTTGACTTGCCCGAGCTGTTGCGCCACGACGTGCCCTTTGTCGCCCGC
CTGCTTGCCGACACGGACCGCCTCATGCTCGACAAGCACTTGCCCTCCTCCACCCTCGACCCTCTCAACACGCCC
GACTTTGCCCTTGACAGCCTCAACCGCGCCCTGCGCCATCTTGACCACTCCCCCTACCTCGGATACGCCTGCCTC
ACCGCCACCCACCCCGACGTCGAGGTGCCCGTCCTCAACAAGAAGCTCACCAAGCCCTTGCACCAGGCTCTGGAT
CCCGCTGCCACCTACCTCCTTGCCGGAGGCCTCGGCGGTCTTGGCCGCAGCATCTCGGAGTTGCTCATCTCCCAC
GGCGTCAAACACTTGGCCTATGTCTCCCGCTCTGGCGCCTCCTCGACCAAGGCCGCCGCCTTTATTGCCGCTCTC
GTCCAGCGTGGCATCAATGCCCGCGCCTACTCGGTCGACTTGTGCAACCACAAACTCCTCACAGACACCATTCGC
GGCCCCATGGCGGCCGAGATGCCTGCCATCAAGGGCGTCTTCCAGTGCGCTGCCGTTATCAAGGACGCCGTCTTT
GACAACATGACTTTTGCCGATTGGAACACGGCCGTCCAGCCCAAGACGCTCGGCACCCACAACTTGGTCCAGGCC
CTCCCCGCCGACAATGATGCATTCTTTGTCTTTCTCGCCAGTTCGGCCGCCGTCATTGGCAGCCGAGGCCAGGCA
AACTATGCCGCCGGCAACTGCTTCCTCGACGCCCTGGCCCACAAGCTTCGTCTTGAGGGCCGTCGCGCCGTCTCC
ATTGATCTCGGCCCAGTCCTCGGCGCCGGTATGCTGGCCGAAGACGAGAACATTCTCACTATTCTGCGCGCCAGC
GGCTTCTATGCCATACGCCACCAAGACTTCATCAAGGTCGTCAGCCATGCCATCACCATGGAGGCCGCTCCCGGC
ATCGACATGCCCCCCCAGGTTGCCCTTGGAGTCGGCACTGGTGGTCTCATGCGCCAAAACAACCCTGCCGACCCC
TACTGGTCCCGCACCGCCTTGTACCAATACCTCAACCTCGTTGACATGCCTGCTCCCGACCTGTCCGTCTCCGAC
TCTGTCGCTGGCTCTGCCACCATGGATCTCAAGACCATGCTAGCCTGCTGCACCGACAAGGCGTCGGCCGCCGAC
ATTATCCAGGCCGGCCTTGTCAATATGCTGGCCAAGGCCATGACCATGCTCCCCGAGGAGCTGGACCCCAACAAG
CCACCCAATGCCTATGGCGTCGATTCGCTTGTTGCCGTCGGTGTTCGCAACTTTGTTATAAACACCTTTGCCGTC
CAGGTGTCCGTATTTGAGGTGCTCAGTGACACCACCATTGCCGAGCTGTCAAGCTCCATTGCCGACAAAGGAGGC
TATGGCAGTCATGCTGAAAGCGTCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail