Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3062
Gene name
LocationContig_20:26339..28207
Strand+
Gene length (bp)1868
Transcript length (bp)1620
Coding sequence length (bp)1620
Protein length (aa) 540

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00891 Methyltransf_2 O-methyltransferase domain 4.0E-25 295 505

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A1DA61|FTMD_NEOFI 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmMT PE=3 SV=1 157 530 6.0E-30
sp|Q4WAW6|FTMD_ASPFU 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmMT PE=1 SV=1 185 530 7.0E-28
sp|B9WZX2|FTMD_ASPFM 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fumigata GN=ftmMT PE=1 SV=1 185 530 5.0E-27
sp|Q12120|OMTA_ASPPA Sterigmatocystin 8-O-methyltransferase OS=Aspergillus parasiticus GN=omtA PE=1 SV=1 150 509 9.0E-27
sp|P55790|OMTA_ASPFL Sterigmatocystin 8-O-methyltransferase OS=Aspergillus flavus GN=omtA PE=3 SV=1 159 509 8.0E-26
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A1DA61|FTMD_NEOFI 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmMT PE=3 SV=1 157 530 6.0E-30
sp|Q4WAW6|FTMD_ASPFU 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmMT PE=1 SV=1 185 530 7.0E-28
sp|B9WZX2|FTMD_ASPFM 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fumigata GN=ftmMT PE=1 SV=1 185 530 5.0E-27
sp|Q12120|OMTA_ASPPA Sterigmatocystin 8-O-methyltransferase OS=Aspergillus parasiticus GN=omtA PE=1 SV=1 150 509 9.0E-27
sp|P55790|OMTA_ASPFL Sterigmatocystin 8-O-methyltransferase OS=Aspergillus flavus GN=omtA PE=3 SV=1 159 509 8.0E-26
sp|Q9P900|OMTB_ASPFL Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus flavus GN=omtB PE=3 SV=1 137 505 8.0E-20
sp|Q9UQY0|OMTB_ASPPA Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus parasiticus GN=omtB PE=1 SV=2 137 505 6.0E-19
sp|Q54GZ0|OMT9_DICDI O-methyltransferase 9 OS=Dictyostelium discoideum GN=omt9 PE=3 SV=1 220 508 1.0E-14
sp|Q54S95|OMT7_DICDI O-methyltransferase 7 OS=Dictyostelium discoideum GN=omt7 PE=3 SV=1 184 508 1.0E-13
sp|Q54B59|OMT12_DICDI O-methyltransferase 12 OS=Dictyostelium discoideum GN=omt12 PE=1 SV=1 221 505 6.0E-13
sp|P16559|TCMN_STRGA Multifunctional cyclase-dehydratase-3-O-methyl transferase TcmN OS=Streptomyces glaucescens GN=tcmN PE=1 SV=2 191 506 9.0E-12
sp|Q38J50|FOMT2_WHEAT Tricetin 3',4',5'-O-trimethyltransferase OS=Triticum aestivum GN=OMT2 PE=1 SV=1 297 505 6.0E-11
sp|Q8GSN1|MOMT_CATRO Myricetin O-methyltransferase OS=Catharanthus roseus PE=1 SV=1 209 505 1.0E-10
sp|Q8GU25|COMT1_ROSCH Caffeic acid 3-O-methyltransferase OS=Rosa chinensis GN=COMT1 PE=2 SV=1 297 501 1.0E-10
sp|Q43046|COMT1_POPKI Caffeic acid 3-O-methyltransferase 1 OS=Populus kitakamiensis GN=HOMT1 PE=3 SV=1 297 501 1.0E-10
sp|Q43609|COMT1_PRUDU Caffeic acid 3-O-methyltransferase OS=Prunus dulcis GN=COMT1 PE=2 SV=1 297 505 3.0E-10
sp|Q00763|COMT1_POPTM Caffeic acid 3-O-methyltransferase 1 OS=Populus tremuloides GN=OMT1 PE=1 SV=1 297 505 7.0E-10
sp|B0EXJ8|HTOMT_CATRO Tabersonine 16-O-methyltransferase OS=Catharanthus roseus GN=16OMT PE=1 SV=1 355 505 8.0E-10
sp|Q41086|COMT2_POPTM Caffeic acid 3-O-methyltransferase 2 OS=Populus tremuloides GN=OMT2 PE=3 SV=1 185 513 1.0E-09
sp|Q43047|COMT3_POPKI Caffeic acid 3-O-methyltransferase 3 OS=Populus kitakamiensis GN=HOMT3 PE=3 SV=1 297 513 1.0E-09
sp|Q43239|COMT1_ZINVI Caffeic acid 3-O-methyltransferase OS=Zinnia violacea PE=2 SV=1 297 516 1.0E-09
sp|Q9LEL6|6OMT_COPJA (RS)-norcoclaurine 6-O-methyltransferase OS=Coptis japonica PE=1 SV=1 166 527 1.0E-09
sp|Q8T638|DMTA_DICDI Des-methyl DIF-1 methyltransferase A OS=Dictyostelium discoideum GN=dmtA PE=1 SV=1 182 505 2.0E-09
sp|Q9FK25|OMT1_ARATH Flavone 3'-O-methyltransferase 1 OS=Arabidopsis thaliana GN=OMT1 PE=1 SV=1 185 514 2.0E-09
sp|Q9FQY8|COMT1_CAPAN Caffeic acid 3-O-methyltransferase OS=Capsicum annuum GN=COMT PE=2 SV=2 297 516 3.0E-09
sp|Q9XGW0|COMT1_OCIBA Caffeic acid 3-O-methyltransferase 1 OS=Ocimum basilicum GN=COMT1 PE=2 SV=1 297 505 4.0E-09
sp|O23760|COMT1_CLABR Caffeic acid 3-O-methyltransferase OS=Clarkia breweri GN=COMT PE=1 SV=1 297 501 5.0E-09
sp|O81646|COMT1_CAPCH Caffeic acid 3-O-methyltransferase OS=Capsicum chinense GN=COMT PE=2 SV=1 297 501 6.0E-09
sp|A8J6X1|BMT_GLELI Bergaptol O-methyltransferase OS=Glehnia littoralis GN=BMT PE=1 SV=1 294 515 6.0E-09
sp|P28002|COMT1_MEDSA Caffeic acid 3-O-methyltransferase OS=Medicago sativa PE=1 SV=1 185 505 7.0E-09
sp|Q6T1F5|COMT1_AMMMJ Caffeic acid 3-O-methyltransferase OS=Ammi majus GN=COMT PE=1 SV=1 297 505 8.0E-09
sp|O82054|COMT1_SACOF Caffeic acid 3-O-methyltransferase OS=Saccharum officinarum GN=COMT PE=2 SV=1 297 505 1.0E-08
sp|P46484|COMT1_EUCGU Caffeic acid 3-O-methyltransferase OS=Eucalyptus gunnii GN=OMT PE=2 SV=1 297 505 2.0E-08
sp|Q8W013|COMT1_CATRO Caffeic acid 3-O-methyltransferase OS=Catharanthus roseus GN=COMT1 PE=2 SV=1 297 512 2.0E-08
sp|B0CN39|SFMM3_STRLA O-methyltransferase SfmM3 OS=Streptomyces lavendulae GN=sfmM3 PE=3 SV=1 190 510 3.0E-08
sp|Q54B60|OMT11_DICDI Probable inactive O-methyltransferase 11 OS=Dictyostelium discoideum GN=omt11 PE=3 SV=1 332 505 4.0E-08
sp|Q9XGV9|COMT2_OCIBA Caffeic acid 3-O-methyltransferase 2 OS=Ocimum basilicum GN=COMT2 PE=2 SV=1 297 501 4.0E-08
sp|Q8H9A8|COOMT_COPJA Columbamine O-methyltransferase OS=Coptis japonica PE=1 SV=1 347 506 5.0E-08
sp|Q8LL87|COMT1_COFCA Caffeic acid 3-O-methyltransferase OS=Coffea canephora PE=2 SV=1 297 505 5.0E-08
sp|Q06509|COMT1_MAIZE Caffeic acid 3-O-methyltransferase OS=Zea mays PE=3 SV=1 297 505 7.0E-08
sp|O04385|IEMT_CLABR (Iso)eugenol O-methyltransferase OS=Clarkia breweri GN=IEMT1 PE=1 SV=2 347 501 1.0E-07
sp|Q6WUC1|6OMT_PAPSO (RS)-norcoclaurine 6-O-methyltransferase OS=Papaver somniferum GN=6OMT PE=1 SV=1 356 527 1.0E-07
sp|Q54527|RDMB_STREF Aclacinomycin 10-hydroxylase RdmB OS=Streptomyces purpurascens GN=rdmB PE=1 SV=1 357 497 2.0E-07
sp|Q42653|OMT2_CHRAE Quercetin 3-O-methyltransferase 2 OS=Chrysosplenium americanum GN=OMT2 PE=1 SV=1 297 505 4.0E-07
sp|C7SDN9|N7OMT_PAPSO Norreticuline-7-O-methyltransferase OS=Papaver somniferum PE=1 SV=1 171 510 2.0E-06
sp|A8QW52|OMT1_SORBI Eugenol O-methyltransferase OS=Sorghum bicolor GN=EOMT PE=1 SV=1 289 505 2.0E-06
sp|D3KU66|ASMT_MOUSE Acetylserotonin O-methyltransferase OS=Mus musculus GN=Asmt PE=2 SV=1 356 505 3.0E-06
sp|Q55216|DNRK_STRS5 Carminomycin 4-O-methyltransferase DauK OS=Streptomyces sp. (strain C5) GN=dauK PE=1 SV=1 205 505 3.0E-06
sp|D3KU67|ASMT_MUSMM Acetylserotonin O-methyltransferase OS=Mus musculus molossinus GN=Asmt PE=2 SV=1 356 505 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008171 O-methyltransferase activity Yes
GO:0008168 methyltransferase activity No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3062
MSTPLLTGARAGRRSLSQYPRLGHTALAMAKFKMPSWLHSTTSMGDAKKHPRRSFAGFSPTKAKHEAMATQHTAM
SKHSDMTVVKSNVSSAQSQLSPPPPPPPPSAVSPMRLLAIKIGLDADVLDEYISSNNLPEPGLDAKAPDEFPRLS
AQMQTRRQELILAVRELLALLRGPRESIRLGAWGALDVAALQVINNYGIAQLVPLDSAIALTELQAKSDMNPVTL
TRVLRFVMTNNIFHEPSPGFIAHTAASRVLAQDAALRDWVGFNTEEVFPASAHVLDALKRDARATSLTATGFNVA
FGTVGSETIFETLGKDPQRARRMVGTMSSMTGSQGYETHYLVDNVDLSKENELEGTLVDIGGSHGLVCVELAQRW
DKMKFVVQDLDKTVQSTPQPICDDPAVAQRIQMQVHDFFQEQPVKNADVYLFRWIIHNYSTPYAVKLLRNLIPAL
KPGARIIINEHCIRTAGAETPWDERLMRSMDMVMMVLLNAEEREENEFRALFEQADARFTFKGVTRTEGCRMSIV
EAVWEPEKMQATKT*
Coding >OphauB2|3062
ATGTCGACGCCTCTGCTAACGGGTGCGCGCGCAGGTCGACGTAGCTTATCGCAGTATCCGCGCCTCGGCCACACA
GCACTGGCCATGGCCAAGTTCAAGATGCCTTCATGGCTGCACTCGACAACAAGCATGGGCGATGCCAAGAAGCAT
CCTCGCCGCTCCTTTGCTGGCTTTTCTCCGACCAAGGCCAAGCACGAGGCCATGGCCACCCAGCACACCGCCATG
TCAAAGCACAGCGACATGACGGTTGTCAAGAGCAACGTGTCGTCGGCGCAGAGCCAGCTGTCGCCCCCGCCCCCG
CCCCCGCCCCCGAGCGCGGTCTCTCCCATGCGCCTTCTGGCAATCAAGATCGGCCTCGACGCAGACGTGTTGGAT
GAGTACATTAGCAGCAACAATCTGCCAGAGCCAGGACTAGACGCCAAGGCCCCCGACGAGTTTCCTCGTCTGTCT
GCCCAGATGCAGACGAGGAGACAGGAGCTTATTCTAGCCGTCAGAGAGCTCCTTGCTCTGTTGCGGGGCCCGCGC
GAGAGCATAAGACTTGGAGCTTGGGGTGCTCTCGACGTGGCCGCCCTGCAAGTCATCAACAACTATGGCATAGCA
CAACTCGTTCCCTTGGATTCTGCCATTGCATTGACAGAGCTTCAGGCCAAGTCTGATATGAACCCAGTAACGCTG
ACTCGCGTCTTGCGCTTTGTAATGACCAATAATATCTTCCACGAGCCTTCACCTGGCTTCATTGCGCATACGGCT
GCCTCGCGAGTTCTCGCTCAAGACGCTGCCTTGCGCGACTGGGTTGGCTTCAACACGGAAGAAGTGTTTCCCGCC
TCGGCCCATGTCCTTGACGCCCTCAAGAGAGACGCCCGAGCCACGTCGCTGACGGCAACCGGCTTCAATGTTGCT
TTTGGTACTGTTGGCAGCGAGACAATTTTTGAGACTCTGGGCAAAGACCCGCAGCGAGCAAGGCGCATGGTGGGA
ACAATGTCGAGCATGACGGGCTCCCAAGGTTACGAGACACACTACCTGGTCGATAATGTTGATTTATCCAAGGAG
AATGAGCTCGAGGGAACACTGGTTGACATTGGAGGCAGCCATGGCCTAGTCTGTGTCGAGCTGGCCCAGAGGTGG
GACAAGATGAAATTTGTCGTTCAGGATCTCGACAAGACAGTGCAAAGCACGCCACAGCCAATCTGTGACGACCCA
GCCGTGGCTCAAAGGATACAAATGCAGGTGCACGACTTCTTCCAAGAGCAGCCCGTCAAGAATGCCGATGTCTAC
CTTTTCCGCTGGATCATCCACAATTACTCGACGCCGTACGCCGTCAAGCTGCTCCGAAACCTGATACCGGCGCTC
AAGCCTGGAGCGCGAATCATCATCAACGAACACTGTATTCGCACGGCAGGTGCCGAGACGCCGTGGGACGAAAGA
TTGATGCGAAGCATGGACATGGTCATGATGGTGCTGCTCAATGCTGAGGAGCGCGAGGAGAATGAGTTTCGGGCT
CTCTTTGAACAGGCTGACGCACGCTTCACTTTCAAGGGCGTCACACGGACCGAGGGCTGCCGAATGAGCATCGTG
GAAGCCGTCTGGGAACCAGAAAAGATGCAAGCAACCAAGACTTGA
Transcript >OphauB2|3062
ATGTCGACGCCTCTGCTAACGGGTGCGCGCGCAGGTCGACGTAGCTTATCGCAGTATCCGCGCCTCGGCCACACA
GCACTGGCCATGGCCAAGTTCAAGATGCCTTCATGGCTGCACTCGACAACAAGCATGGGCGATGCCAAGAAGCAT
CCTCGCCGCTCCTTTGCTGGCTTTTCTCCGACCAAGGCCAAGCACGAGGCCATGGCCACCCAGCACACCGCCATG
TCAAAGCACAGCGACATGACGGTTGTCAAGAGCAACGTGTCGTCGGCGCAGAGCCAGCTGTCGCCCCCGCCCCCG
CCCCCGCCCCCGAGCGCGGTCTCTCCCATGCGCCTTCTGGCAATCAAGATCGGCCTCGACGCAGACGTGTTGGAT
GAGTACATTAGCAGCAACAATCTGCCAGAGCCAGGACTAGACGCCAAGGCCCCCGACGAGTTTCCTCGTCTGTCT
GCCCAGATGCAGACGAGGAGACAGGAGCTTATTCTAGCCGTCAGAGAGCTCCTTGCTCTGTTGCGGGGCCCGCGC
GAGAGCATAAGACTTGGAGCTTGGGGTGCTCTCGACGTGGCCGCCCTGCAAGTCATCAACAACTATGGCATAGCA
CAACTCGTTCCCTTGGATTCTGCCATTGCATTGACAGAGCTTCAGGCCAAGTCTGATATGAACCCAGTAACGCTG
ACTCGCGTCTTGCGCTTTGTAATGACCAATAATATCTTCCACGAGCCTTCACCTGGCTTCATTGCGCATACGGCT
GCCTCGCGAGTTCTCGCTCAAGACGCTGCCTTGCGCGACTGGGTTGGCTTCAACACGGAAGAAGTGTTTCCCGCC
TCGGCCCATGTCCTTGACGCCCTCAAGAGAGACGCCCGAGCCACGTCGCTGACGGCAACCGGCTTCAATGTTGCT
TTTGGTACTGTTGGCAGCGAGACAATTTTTGAGACTCTGGGCAAAGACCCGCAGCGAGCAAGGCGCATGGTGGGA
ACAATGTCGAGCATGACGGGCTCCCAAGGTTACGAGACACACTACCTGGTCGATAATGTTGATTTATCCAAGGAG
AATGAGCTCGAGGGAACACTGGTTGACATTGGAGGCAGCCATGGCCTAGTCTGTGTCGAGCTGGCCCAGAGGTGG
GACAAGATGAAATTTGTCGTTCAGGATCTCGACAAGACAGTGCAAAGCACGCCACAGCCAATCTGTGACGACCCA
GCCGTGGCTCAAAGGATACAAATGCAGGTGCACGACTTCTTCCAAGAGCAGCCCGTCAAGAATGCCGATGTCTAC
CTTTTCCGCTGGATCATCCACAATTACTCGACGCCGTACGCCGTCAAGCTGCTCCGAAACCTGATACCGGCGCTC
AAGCCTGGAGCGCGAATCATCATCAACGAACACTGTATTCGCACGGCAGGTGCCGAGACGCCGTGGGACGAAAGA
TTGATGCGAAGCATGGACATGGTCATGATGGTGCTGCTCAATGCTGAGGAGCGCGAGGAGAATGAGTTTCGGGCT
CTCTTTGAACAGGCTGACGCACGCTTCACTTTCAAGGGCGTCACACGGACCGAGGGCTGCCGAATGAGCATCGTG
GAAGCCGTCTGGGAACCAGAAAAGATGCAAGCAACCAAGACTTGA
Gene >OphauB2|3062
ATGTCGACGCCTCTGCTAACGGGTGCGCGCGCAGGTCGACGTAGCTTATCGCAGTATCCGCGCCTCGGCCACACA
GCACTGGCCATGGCCAAGTTCAAGATGCCTTCATGGCTGCACTCGACAACAAGCATGGGCGATGCCAAGAAGCAT
CCTCGCCGCTCCTTTGCTGGCTTTTCTCCGACCAAGGCCAAGCACGAGGCCATGGCCACCCAGCACACCGCCATG
TCAAAGCACAGCGACATGACGGTTGTCAAGAGCAACGTGTCGTCGGCGCAGAGCCAGCTGTCGCCCCCGCCCCCG
CCCCCGCCCCCGAGCGCGGTCTCTCCCATGCGCCTTCTGGCAATCAAGATCGGCCTCGACGCAGACGTGTTGGAT
GAGTACATTAGCAGCAACAATCTGCCAGAGCCAGGACTAGACGCCAAGGCCCCCGACGAGTTTCCTCGTCTGTCT
GCCCAGATGCAGACGAGGAGACAGGAGCTTATTCTAGCCGTCAGAGAGCTCCTTGCTCTGTTGCGGGGCCCGCGC
GAGAGCATAAGACTTGGAGCTTGGGGTGTAAGGCTTTGCTTTGACGCCTTTTGCTGCTCTTTTGTGGTTGACTCT
TCTGCCAGGCTCTCGACGTGGCCGCCCTGCAAGTCATCAACAACTATGGCATAGGTAGCGGCTCTTGTCCCTATG
GCTGGCGCCATGTGCTGACCTGGACACTAGCACAACTCGTTCCCTTGGATTCTGCCATTGCATTGACAGAGCTTC
AGGCCAAGTCTGATATGAACCCAGTAACGCTGACTCGCGTCTTGCGCTTTGTAATGACCAATAATATCTTCCACG
AGCCTTCACCTGGCTTCATTGCGCATACGGCTGCCTCGCGAGTTCTCGCTCAAGACGCTGCCTTGCGCGACTGGG
TTGGCTTCAACACGGAAGAAGTGTTTCCCGCCTCGGCCCATGTCCTTGACGCCCTCAAGAGAGACGCCCGAGCCA
CGTCGCTGACGGCAACCGGCTTCAATGTTGCTTTTGGTACTGTTGGCAGCGAGACAATTTTTGAGACTCTGGGCA
AAGACCCGCAGCGAGCAAGGCGCATGGTGGGAACAATGTCGAGCATGACGGGCTCCCAAGGTTACGAGACACACT
ACCTGGTCGATAATGTTGATTTATCCAAGGAGAATGAGCTCGAGGGAACACTGGTTGACATTGGAGGCAGCCATG
GCCTAGTCTGTGTCGAGCTGGCCCAGAGGTGGGACAAGATGAAATTTGTCGTTCAGGATCTCGACAAGACAGTGC
AAAGCACGCCACAGCCAATCTGTGACGACCCAGCCGTGGCTCAAAGGATACAAATGCAGGTGCACGACTTCTTCC
AAGAGCAGCCCGTCAAGAATGCCGATGGTATGGCACCGTCCCCCTTGTCTGTCTCCTGGCACCAAGTCACTGAGC
TGACGAGCTTGCCTGGCTCCCAACAGTCTACCTTTTCCGCTGGATCATCCACAATTACTCGACGCCGTACGCCGT
CAAGCTGCTCCGAAACCTGATACCGGCGCTCAAGCCTGGAGCGCGAATCATCATCAACGAACACTGTATTCGCAC
GGCAGGTGCCGAGACGCCGTGGGACGAAAGATTGATGCGAAGCATGGACATGGTCATGATGGTGCTGCTCAATGC
TGAGGAGCGCGAGGAGAATGAGTTTCGGGCTCTCTTTGAACAGGCTGACGCACGCTTCACTTTCAAGGTGACTGG
CTGCATGCCTCGTTGTCTTTGGTGTTTTTTTTTTTCTTTTTCGCTGACTTGCAGCCTAGGGCGTCACACGGACCG
AGGGCTGCCGAATGAGCATCGTGGAAGCCGTCTGGGAACCAGAAAAGATGCAAGCAACCAAGACTTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail