Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3054
Gene name
LocationContig_2:404806..406384
Strand-
Gene length (bp)1578
Transcript length (bp)1521
Coding sequence length (bp)1521
Protein length (aa) 507

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14608 zf-CCCH_2 RNA-binding, Nab2-type zinc finger 3.4E-01 332 347
PF14608 zf-CCCH_2 RNA-binding, Nab2-type zinc finger 1.2E-04 393 410
PF14608 zf-CCCH_2 RNA-binding, Nab2-type zinc finger 1.2E-02 414 430
PF14608 zf-CCCH_2 RNA-binding, Nab2-type zinc finger 1.8E+00 435 449

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P32505|NAB2_YEAST Nuclear polyadenylated RNA-binding protein NAB2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAB2 PE=1 SV=1 300 453 1.0E-11
sp|O13713|NAB2_SCHPO Nuclear polyadenylated RNA-binding protein nab2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nab2 PE=3 SV=1 7 146 3.0E-08
sp|O13713|NAB2_SCHPO Nuclear polyadenylated RNA-binding protein nab2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nab2 PE=3 SV=1 328 411 7.0E-08
sp|Q5TYQ8|ZC3HE_DANRE Zinc finger CCCH domain-containing protein 14 OS=Danio rerio GN=zc3h14 PE=2 SV=1 309 430 2.0E-07
sp|Q7TMD5|ZC3HE_RAT Zinc finger CCCH domain-containing protein 14 OS=Rattus norvegicus GN=Zc3h14 PE=1 SV=1 255 430 5.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P32505|NAB2_YEAST Nuclear polyadenylated RNA-binding protein NAB2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAB2 PE=1 SV=1 300 453 1.0E-11
sp|O13713|NAB2_SCHPO Nuclear polyadenylated RNA-binding protein nab2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nab2 PE=3 SV=1 7 146 3.0E-08
sp|O13713|NAB2_SCHPO Nuclear polyadenylated RNA-binding protein nab2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nab2 PE=3 SV=1 328 411 7.0E-08
sp|Q5TYQ8|ZC3HE_DANRE Zinc finger CCCH domain-containing protein 14 OS=Danio rerio GN=zc3h14 PE=2 SV=1 309 430 2.0E-07
sp|Q7TMD5|ZC3HE_RAT Zinc finger CCCH domain-containing protein 14 OS=Rattus norvegicus GN=Zc3h14 PE=1 SV=1 255 430 5.0E-07
sp|Q5F3Z9|ZC3HE_CHICK Zinc finger CCCH domain-containing protein 14 OS=Gallus gallus GN=ZC3H14 PE=2 SV=1 360 449 1.0E-06
sp|Q3ZC82|ZC3HE_BOVIN Zinc finger CCCH domain-containing protein 14 OS=Bos taurus GN=ZC3H14 PE=2 SV=2 364 449 2.0E-06
sp|Q4R6F6|ZC3HE_MACFA Zinc finger CCCH domain-containing protein 14 OS=Macaca fascicularis GN=ZC3H14 PE=2 SV=2 255 449 4.0E-06
sp|Q6PJT7|ZC3HE_HUMAN Zinc finger CCCH domain-containing protein 14 OS=Homo sapiens GN=ZC3H14 PE=1 SV=1 255 449 4.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 15 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3054
MSVEISLNTPLADALNTAIKPKLVEVGWGTGGSDDSALAEYVILMLVNGKTQDQIAAELSGELLSLPADDPGVHD
FSKWLFEQIDRLSRQVKTDGETLPDQAQEARNSADVDTEMTSNDVSELNVPTGPRSMRNNNVRGARDRRILGHMN
KAMDRSGDAPLHRTRGNDRINTHGRPLPMGPRAGLGRAQRNSNNNLNNNNFRAASLQAGLGASSGPPGPSWNVYG
PQPNQMELMAILEQQNQMMLQLSQQLMNGGAPSAPNGFGQRRGKSLFERVSDPQQRNNLRKGGTGNHHSHTNSNI
KAANKDAAEAESDDIEMADSKHEPLKAEETVCKFNLNCTNKECKYAHQSPAAAAGISIDVNDTCSFGAACKNKKC
VGRHPSPATKLAHQGEQDCKFFPNCQNPRCPFRHPSMPLCRNGPGCTTANCKFTHVKTKCKFSPCLNPHCVFAHE
EGQQGSFRDKVWTAEAEEHVSERKFVDEGAAPERVRPGEGEEAMATTREQAAEVSG*
Coding >OphauB2|3054
ATGTCTGTCGAAATAAGTCTCAACACCCCCTTGGCTGATGCGCTTAACACTGCCATCAAGCCCAAGTTGGTCGAA
GTAGGCTGGGGAACTGGGGGCTCCGACGACTCGGCTCTGGCTGAATATGTCATTTTGATGCTTGTCAATGGCAAA
ACTCAGGATCAAATTGCCGCGGAACTCTCTGGAGAGCTGCTCAGTTTGCCTGCAGACGACCCAGGGGTCCACGAC
TTTTCAAAATGGCTGTTTGAACAAATCGACCGTCTGAGTCGACAGGTGAAGACGGATGGCGAGACTTTGCCCGAC
CAAGCGCAGGAGGCCCGTAACTCGGCAGATGTCGACACAGAAATGACATCAAACGACGTGTCCGAGTTGAATGTG
CCTACCGGGCCACGATCGATGCGCAATAATAATGTGCGCGGTGCAAGGGACAGACGAATACTGGGCCACATGAAC
AAAGCCATGGATCGCTCTGGTGATGCCCCGCTGCATCGTACTCGAGGCAACGACAGAATAAATACTCACGGACGA
CCTCTTCCAATGGGCCCTCGAGCGGGGCTCGGACGAGCACAGCGCAACAGCAATAATAACTTGAATAATAACAAC
TTTCGGGCAGCCAGCCTTCAGGCTGGTCTTGGTGCGTCTTCGGGACCTCCAGGACCCAGCTGGAACGTGTACGGC
CCACAGCCCAACCAAATGGAGCTCATGGCAATTTTGGAACAACAAAACCAAATGATGCTTCAGCTCTCGCAGCAA
CTCATGAATGGCGGGGCACCTTCGGCACCGAATGGCTTTGGGCAACGGCGTGGCAAATCGCTCTTTGAGCGAGTG
TCTGACCCCCAGCAGCGAAACAACTTGCGCAAGGGAGGCACGGGCAACCACCATTCACACACAAACAGCAATATC
AAGGCGGCCAACAAGGACGCAGCAGAGGCAGAGAGTGACGACATTGAAATGGCGGATTCGAAACACGAGCCTCTC
AAAGCTGAGGAAACGGTGTGCAAGTTTAACTTGAATTGCACCAACAAGGAATGCAAATATGCTCATCAATCACCG
GCGGCGGCAGCAGGGATATCAATTGATGTCAATGACACGTGCAGTTTTGGAGCGGCATGCAAAAACAAGAAGTGC
GTCGGACGACATCCATCGCCAGCTACCAAGTTGGCACACCAGGGCGAGCAAGACTGCAAGTTTTTCCCCAACTGT
CAGAACCCGCGGTGTCCATTCCGGCACCCGTCAATGCCTCTTTGCCGCAACGGGCCGGGCTGCACGACAGCGAAC
TGCAAGTTTACGCATGTCAAGACCAAGTGCAAATTCTCGCCATGTCTCAACCCGCACTGTGTGTTTGCACATGAG
GAGGGCCAGCAAGGCAGCTTCAGGGACAAGGTGTGGACGGCCGAGGCGGAGGAGCATGTGAGTGAGAGAAAGTTT
GTGGACGAGGGAGCAGCGCCGGAGCGTGTCAGACCTGGTGAAGGCGAGGAAGCCATGGCTACGACAAGGGAGCAA
GCAGCCGAAGTGAGTGGTTAA
Transcript >OphauB2|3054
ATGTCTGTCGAAATAAGTCTCAACACCCCCTTGGCTGATGCGCTTAACACTGCCATCAAGCCCAAGTTGGTCGAA
GTAGGCTGGGGAACTGGGGGCTCCGACGACTCGGCTCTGGCTGAATATGTCATTTTGATGCTTGTCAATGGCAAA
ACTCAGGATCAAATTGCCGCGGAACTCTCTGGAGAGCTGCTCAGTTTGCCTGCAGACGACCCAGGGGTCCACGAC
TTTTCAAAATGGCTGTTTGAACAAATCGACCGTCTGAGTCGACAGGTGAAGACGGATGGCGAGACTTTGCCCGAC
CAAGCGCAGGAGGCCCGTAACTCGGCAGATGTCGACACAGAAATGACATCAAACGACGTGTCCGAGTTGAATGTG
CCTACCGGGCCACGATCGATGCGCAATAATAATGTGCGCGGTGCAAGGGACAGACGAATACTGGGCCACATGAAC
AAAGCCATGGATCGCTCTGGTGATGCCCCGCTGCATCGTACTCGAGGCAACGACAGAATAAATACTCACGGACGA
CCTCTTCCAATGGGCCCTCGAGCGGGGCTCGGACGAGCACAGCGCAACAGCAATAATAACTTGAATAATAACAAC
TTTCGGGCAGCCAGCCTTCAGGCTGGTCTTGGTGCGTCTTCGGGACCTCCAGGACCCAGCTGGAACGTGTACGGC
CCACAGCCCAACCAAATGGAGCTCATGGCAATTTTGGAACAACAAAACCAAATGATGCTTCAGCTCTCGCAGCAA
CTCATGAATGGCGGGGCACCTTCGGCACCGAATGGCTTTGGGCAACGGCGTGGCAAATCGCTCTTTGAGCGAGTG
TCTGACCCCCAGCAGCGAAACAACTTGCGCAAGGGAGGCACGGGCAACCACCATTCACACACAAACAGCAATATC
AAGGCGGCCAACAAGGACGCAGCAGAGGCAGAGAGTGACGACATTGAAATGGCGGATTCGAAACACGAGCCTCTC
AAAGCTGAGGAAACGGTGTGCAAGTTTAACTTGAATTGCACCAACAAGGAATGCAAATATGCTCATCAATCACCG
GCGGCGGCAGCAGGGATATCAATTGATGTCAATGACACGTGCAGTTTTGGAGCGGCATGCAAAAACAAGAAGTGC
GTCGGACGACATCCATCGCCAGCTACCAAGTTGGCACACCAGGGCGAGCAAGACTGCAAGTTTTTCCCCAACTGT
CAGAACCCGCGGTGTCCATTCCGGCACCCGTCAATGCCTCTTTGCCGCAACGGGCCGGGCTGCACGACAGCGAAC
TGCAAGTTTACGCATGTCAAGACCAAGTGCAAATTCTCGCCATGTCTCAACCCGCACTGTGTGTTTGCACATGAG
GAGGGCCAGCAAGGCAGCTTCAGGGACAAGGTGTGGACGGCCGAGGCGGAGGAGCATGTGAGTGAGAGAAAGTTT
GTGGACGAGGGAGCAGCGCCGGAGCGTGTCAGACCTGGTGAAGGCGAGGAAGCCATGGCTACGACAAGGGAGCAA
GCAGCCGAAGTGAGTGGTTAA
Gene >OphauB2|3054
ATGTCTGTCGAAATAAGTCTCAACACCCCCTTGGCTGATGCGCTTAACACTGCCATCAAGCCCAAGTTGGTCGAA
GTAGGCTGGGGAACTGGGGGCTCCGACGACTCGGCTCTGGCTGAATATGTCATTTTGATGCTTGTCAATGGCAAA
ACTCAGGATCAAATTGCCGCGGAACTCTCTGGAGAGCTGCTCAGTTTGCCTGCAGACGACCCAGGGGTCCACGAC
TTTTCAAAATGGCTGTTTGAACAAATCGACCGTCTGAGTCGACAGGTGAAGACGGATGGCGAGACTTTGCCCGAC
CAAGCGCAGGAGGCCCGTAACTCGGCAGATGTCGACACAGAAATGACATCAAACGACGTGTCCGAGTTGAATGTG
TTTGTTTCTCTGGCCCCGAATACCGATTAACTGCAGCAGCTAACGGGTTTCAATAGGCCTACCGGGCCACGATCG
ATGCGCAATAATAATGTGCGCGGTGCAAGGGACAGACGAATACTGGGCCACATGAACAAAGCCATGGATCGCTCT
GGTGATGCCCCGCTGCATCGTACTCGAGGCAACGACAGAATAAATACTCACGGACGACCTCTTCCAATGGGCCCT
CGAGCGGGGCTCGGACGAGCACAGCGCAACAGCAATAATAACTTGAATAATAACAACTTTCGGGCAGCCAGCCTT
CAGGCTGGTCTTGGTGCGTCTTCGGGACCTCCAGGACCCAGCTGGAACGTGTACGGCCCACAGCCCAACCAAATG
GAGCTCATGGCAATTTTGGAACAACAAAACCAAATGATGCTTCAGCTCTCGCAGCAACTCATGAATGGCGGGGCA
CCTTCGGCACCGAATGGCTTTGGGCAACGGCGTGGCAAATCGCTCTTTGAGCGAGTGTCTGACCCCCAGCAGCGA
AACAACTTGCGCAAGGGAGGCACGGGCAACCACCATTCACACACAAACAGCAATATCAAGGCGGCCAACAAGGAC
GCAGCAGAGGCAGAGAGTGACGACATTGAAATGGCGGATTCGAAACACGAGCCTCTCAAAGCTGAGGAAACGGTG
TGCAAGTTTAACTTGAATTGCACCAACAAGGAATGCAAATATGCTCATCAATCACCGGCGGCGGCAGCAGGGATA
TCAATTGATGTCAATGACACGTGCAGTTTTGGAGCGGCATGCAAAAACAAGAAGTGCGTCGGACGACATCCATCG
CCAGCTACCAAGTTGGCACACCAGGGCGAGCAAGACTGCAAGTTTTTCCCCAACTGTCAGAACCCGCGGTGTCCA
TTCCGGCACCCGTCAATGCCTCTTTGCCGCAACGGGCCGGGCTGCACGACAGCGAACTGCAAGTTTACGCATGTC
AAGACCAAGTGCAAATTCTCGCCATGTCTCAACCCGCACTGTGTGTTTGCACATGAGGAGGGCCAGCAAGGCAGC
TTCAGGGACAAGGTGTGGACGGCCGAGGCGGAGGAGCATGTGAGTGAGAGAAAGTTTGTGGACGAGGGAGCAGCG
CCGGAGCGTGTCAGACCTGGTGAAGGCGAGGAAGCCATGGCTACGACAAGGGAGCAAGCAGCCGAAGTGAGTGGT
TAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail