Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3053
Gene name
LocationContig_2:402343..404193
Strand-
Gene length (bp)1850
Transcript length (bp)1710
Coding sequence length (bp)1710
Protein length (aa) 570

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01593 Amino_oxidase Flavin containing amine oxidoreductase 4.0E-20 35 532
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 2.3E-11 30 101
PF01266 DAO FAD dependent oxidoreductase 6.9E-07 27 65

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10062|PPOX_SCHPO Protoporphyrinogen oxidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hem14 PE=3 SV=1 28 532 1.0E-47
sp|P40012|PPOX_YEAST Protoporphyrinogen oxidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HEM14 PE=1 SV=1 38 533 3.0E-27
sp|P50336|PPOX_HUMAN Protoporphyrinogen oxidase OS=Homo sapiens GN=PPOX PE=1 SV=1 25 532 1.0E-25
sp|P56602|PPOX_BOVIN Protoporphyrinogen oxidase OS=Bos taurus GN=PPOX PE=1 SV=2 25 532 1.0E-24
sp|P51175|PPOX_MOUSE Protoporphyrinogen oxidase OS=Mus musculus GN=Ppox PE=1 SV=1 25 529 1.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10062|PPOX_SCHPO Protoporphyrinogen oxidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hem14 PE=3 SV=1 28 532 1.0E-47
sp|P40012|PPOX_YEAST Protoporphyrinogen oxidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HEM14 PE=1 SV=1 38 533 3.0E-27
sp|P50336|PPOX_HUMAN Protoporphyrinogen oxidase OS=Homo sapiens GN=PPOX PE=1 SV=1 25 532 1.0E-25
sp|P56602|PPOX_BOVIN Protoporphyrinogen oxidase OS=Bos taurus GN=PPOX PE=1 SV=2 25 532 1.0E-24
sp|P51175|PPOX_MOUSE Protoporphyrinogen oxidase OS=Mus musculus GN=Ppox PE=1 SV=1 25 529 1.0E-23
sp|Q60HD5|PPOX_MACFA Protoporphyrinogen oxidase OS=Macaca fascicularis GN=PPOX PE=2 SV=1 25 532 3.0E-23
sp|P55826|PPOC_ARATH Protoporphyrinogen oxidase 1, chloroplastic OS=Arabidopsis thaliana GN=PPOX1 PE=1 SV=1 30 534 1.0E-13
sp|O32434|PPOX_PROFF Protoporphyrinogen oxidase OS=Propionibacterium freudenreichii subsp. freudenreichii GN=hemY PE=3 SV=1 13 227 9.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3053
MALRLGQRARQATSGARHYGTDSSGPHVGIIGGGLTGLTTAYYLAKRLPRTTRLTVYEASDRLGGWLQTERVEGS
GMGLEVGRELEGARIAFERGPRTLTSLRETTWRLDDLVLWDVAHGVGLEVVSPADQARHVCYGDKLVKLPDAQGG
YGRLAHPLFLGLAGAALHYGLGRLLHGRPRMPADDVSIAAWLRQLTGSDAVADRLASAMVHGIYGGDVDRLSARW
VLEGAFVSTYMGRPPPGCCFMPAHEADLLADLAPLPHVARLASRPHASLLHFGAAGIEALPQALARALHAHPNVQ
VRTGCRVDAIRRHESQQHLTLSLAGAKGQRQSQHHHRVVAALDAASLLRASATELPSLAAAPSVSIMTVNLWYPQ
PQLNPRGFGYLIPRCQEPTNPERALGVFFDSDVGLAGPAVGEPPATKLFVLLGGHYYGGDESRGQVQPPSAPQAV
AQAKAVLERHLAIPRHTPCFAMARPAWNCIPQHTLGHGQRMRTAHHELHAAFGGRLTVAGGSYSRIGVMGALRAG
YDAARRITDSAAATGLERFVDPDPLANIVAVPKSKLAPVRALKP*
Coding >OphauB2|3053
ATGGCTCTGCGTCTTGGGCAAAGAGCGAGACAGGCGACAAGCGGCGCACGGCACTATGGCACGGACAGCTCGGGG
CCGCACGTGGGGATCATTGGCGGGGGGCTGACGGGCCTGACGACGGCCTACTACCTGGCCAAGAGGCTGCCGCGG
ACGACGAGGCTGACGGTGTATGAAGCAAGCGACCGGCTGGGGGGCTGGCTGCAGACGGAGCGCGTGGAGGGGAGC
GGCATGGGCCTGGAGGTGGGCCGGGAGCTGGAGGGCGCGCGGATTGCGTTTGAGCGCGGGCCGCGGACGCTGACG
TCGCTGCGAGAGACGACGTGGCGGCTGGATGACCTGGTGCTGTGGGACGTGGCGCATGGCGTGGGGCTCGAGGTA
GTCTCGCCGGCGGACCAGGCGCGCCATGTGTGCTACGGCGACAAGCTGGTGAAGCTGCCCGACGCGCAGGGCGGC
TATGGGCGGCTGGCGCACCCGCTCTTCCTCGGGCTGGCGGGCGCGGCGCTGCACTATGGGCTGGGGCGGCTGTTG
CACGGACGGCCTCGCATGCCCGCCGACGACGTGTCCATTGCTGCCTGGCTGCGCCAGCTGACGGGCAGCGACGCC
GTGGCCGACAGGCTGGCCTCGGCCATGGTGCACGGCATCTACGGCGGCGACGTGGACCGCCTCAGCGCGCGCTGG
GTCCTCGAGGGCGCCTTTGTGTCCACCTACATGGGCCGCCCGCCCCCCGGCTGCTGCTTCATGCCCGCCCACGAG
GCCGACCTGCTCGCCGACCTGGCCCCGCTGCCCCATGTCGCCCGTCTGGCCTCGCGCCCCCACGCCTCCCTGCTG
CACTTTGGCGCCGCTGGCATCGAGGCCCTGCCCCAGGCCCTGGCCCGCGCTCTCCACGCCCACCCCAACGTGCAG
GTGCGCACCGGCTGCCGCGTCGACGCCATTCGCCGCCACGAGTCGCAGCAGCACCTGACGCTTAGCCTCGCCGGA
GCCAAGGGCCAGCGCCAGAGTCAGCACCACCACCGCGTCGTGGCCGCCCTCGATGCCGCCTCGCTGCTGCGGGCC
TCGGCCACGGAGCTGCCGTCGCTCGCCGCCGCGCCCTCCGTCTCCATCATGACGGTCAACCTGTGGTACCCGCAG
CCGCAGCTCAACCCTCGCGGCTTCGGCTACCTCATTCCCCGCTGCCAAGAGCCCACCAACCCCGAGCGCGCCCTC
GGCGTCTTCTTCGACTCCGACGTTGGTCTCGCCGGCCCTGCCGTTGGCGAGCCGCCCGCTACCAAGCTCTTTGTC
CTCCTGGGCGGCCACTACTACGGCGGCGACGAGAGCCGAGGCCAGGTCCAGCCCCCGTCCGCCCCGCAGGCTGTC
GCCCAGGCCAAGGCGGTCCTCGAGCGCCACTTGGCCATTCCTCGCCACACGCCCTGCTTTGCCATGGCCCGCCCT
GCCTGGAACTGCATCCCGCAGCACACGCTTGGCCACGGCCAGCGCATGCGCACTGCCCACCACGAGCTCCACGCC
GCCTTTGGAGGCCGTCTCACCGTGGCCGGAGGCTCCTACTCCCGCATCGGCGTCATGGGCGCCCTCCGCGCAGGC
TATGACGCTGCCCGACGCATCACTGACAGCGCCGCCGCCACGGGGCTCGAGAGATTTGTCGACCCGGACCCCTTG
GCCAACATTGTTGCCGTGCCCAAGTCCAAGCTGGCCCCCGTGCGCGCCTTGAAGCCGTGA
Transcript >OphauB2|3053
ATGGCTCTGCGTCTTGGGCAAAGAGCGAGACAGGCGACAAGCGGCGCACGGCACTATGGCACGGACAGCTCGGGG
CCGCACGTGGGGATCATTGGCGGGGGGCTGACGGGCCTGACGACGGCCTACTACCTGGCCAAGAGGCTGCCGCGG
ACGACGAGGCTGACGGTGTATGAAGCAAGCGACCGGCTGGGGGGCTGGCTGCAGACGGAGCGCGTGGAGGGGAGC
GGCATGGGCCTGGAGGTGGGCCGGGAGCTGGAGGGCGCGCGGATTGCGTTTGAGCGCGGGCCGCGGACGCTGACG
TCGCTGCGAGAGACGACGTGGCGGCTGGATGACCTGGTGCTGTGGGACGTGGCGCATGGCGTGGGGCTCGAGGTA
GTCTCGCCGGCGGACCAGGCGCGCCATGTGTGCTACGGCGACAAGCTGGTGAAGCTGCCCGACGCGCAGGGCGGC
TATGGGCGGCTGGCGCACCCGCTCTTCCTCGGGCTGGCGGGCGCGGCGCTGCACTATGGGCTGGGGCGGCTGTTG
CACGGACGGCCTCGCATGCCCGCCGACGACGTGTCCATTGCTGCCTGGCTGCGCCAGCTGACGGGCAGCGACGCC
GTGGCCGACAGGCTGGCCTCGGCCATGGTGCACGGCATCTACGGCGGCGACGTGGACCGCCTCAGCGCGCGCTGG
GTCCTCGAGGGCGCCTTTGTGTCCACCTACATGGGCCGCCCGCCCCCCGGCTGCTGCTTCATGCCCGCCCACGAG
GCCGACCTGCTCGCCGACCTGGCCCCGCTGCCCCATGTCGCCCGTCTGGCCTCGCGCCCCCACGCCTCCCTGCTG
CACTTTGGCGCCGCTGGCATCGAGGCCCTGCCCCAGGCCCTGGCCCGCGCTCTCCACGCCCACCCCAACGTGCAG
GTGCGCACCGGCTGCCGCGTCGACGCCATTCGCCGCCACGAGTCGCAGCAGCACCTGACGCTTAGCCTCGCCGGA
GCCAAGGGCCAGCGCCAGAGTCAGCACCACCACCGCGTCGTGGCCGCCCTCGATGCCGCCTCGCTGCTGCGGGCC
TCGGCCACGGAGCTGCCGTCGCTCGCCGCCGCGCCCTCCGTCTCCATCATGACGGTCAACCTGTGGTACCCGCAG
CCGCAGCTCAACCCTCGCGGCTTCGGCTACCTCATTCCCCGCTGCCAAGAGCCCACCAACCCCGAGCGCGCCCTC
GGCGTCTTCTTCGACTCCGACGTTGGTCTCGCCGGCCCTGCCGTTGGCGAGCCGCCCGCTACCAAGCTCTTTGTC
CTCCTGGGCGGCCACTACTACGGCGGCGACGAGAGCCGAGGCCAGGTCCAGCCCCCGTCCGCCCCGCAGGCTGTC
GCCCAGGCCAAGGCGGTCCTCGAGCGCCACTTGGCCATTCCTCGCCACACGCCCTGCTTTGCCATGGCCCGCCCT
GCCTGGAACTGCATCCCGCAGCACACGCTTGGCCACGGCCAGCGCATGCGCACTGCCCACCACGAGCTCCACGCC
GCCTTTGGAGGCCGTCTCACCGTGGCCGGAGGCTCCTACTCCCGCATCGGCGTCATGGGCGCCCTCCGCGCAGGC
TATGACGCTGCCCGACGCATCACTGACAGCGCCGCCGCCACGGGGCTCGAGAGATTTGTCGACCCGGACCCCTTG
GCCAACATTGTTGCCGTGCCCAAGTCCAAGCTGGCCCCCGTGCGCGCCTTGAAGCCGTGA
Gene >OphauB2|3053
ATGGCTCTGCGTCTTGGGCAAAGAGCGAGACAGGCGACAAGCGGCGCACGGCACTATGGCACGGACAGCTCGGGG
CCGCACGTGGGGATCATTGGCGGGGGGCTGACGGGCCTGACGACGGCCTACTACCTGGCCAAGAGGCTGCCGCGG
ACGACGAGGCTGACGGTGTATGAAGCAAGCGACCGGCTGGGGGGCTGGCTGCAGACGGAGCGCGTGGAGGGGAGC
GGCATGGGCCTGGAGGTGGGCCGGGAGCTGGAGGGCGCGCGGATTGCGTTTGAGCGCGGGCCGCGGACGCTGACG
TCGCTGCGAGAGACGACGTGGCGGCTGGATGACCTGGTGCTGTGGGACGTGGTGGGTTGGCCATGAGGAGGTTGG
CCATGAGGAGGTTGGCCATGAGGAGGCTGGTGGACACAGGGCTGACGACGACGGCTGCAGGCGCATGGCGTGGGG
CTCGAGGTAGTCTCGCCGGCGGACCAGGCGCGCCATGTGTGCTACGGCGACAAGCTGGTGAAGCTGCCCGACGCG
CAGGGCGGCTATGGGCGGCTGGCGCACCCGCTCTTCCTCGGGCTGGCGGGCGCGGCGCTGCACTATGGGCTGGGG
CGGCTGTTGCACGGACGGCCTCGCATGCCCGCCGACGACGTGTCCATTGCTGCCTGGCTGCGCCAGCTGACGGGC
AGCGACGCCGTGGCCGACAGGCTGGCCTCGGCCATGGTGCACGGCATCTACGGCGGCGACGTGGACCGCCTCAGC
GCGCGCTGGGTCCTCGAGGGCGCCTTTGTGTCCACCTACATGGGCCGCCCGCCCCCCGGCTGCTGCTTCATGCCC
GCCCACGAGGCCGACCTGCTCGCCGACCTGGCCCCGCTGCCCCATGTCGCCCGTCTGGCCTCGCGCCCCCACGCC
TCCCTGCTGCACTTTGGCGCCGCTGGCATCGAGGCCCTGCCCCAGGCCCTGGCCCGCGCTCTCCACGCCCACCCC
AACGTGCAGGTGCGCACCGGCTGCCGCGTCGACGCCATTCGCCGCCACGAGTCGCAGCAGCACCTGACGGTAGGC
CCTCCTCTGCCTCGCCCCCCCCCGAGCGCCCTCGCCTAAACCTCGTGCAGCTTAGCCTCGCCGGAGCCAAGGGCC
AGCGCCAGAGTCAGCACCACCACCGCGTCGTGGCCGCCCTCGATGCCGCCTCGCTGCTGCGGGCCTCGGCCACGG
AGCTGCCGTCGCTCGCCGCCGCGCCCTCCGTCTCCATCATGACGGTCAACCTGTGGTACCCGCAGCCGCAGCTCA
ACCCTCGCGGCTTCGGCTACCTCATTCCCCGCTGCCAAGAGCCCACCAACCCCGAGCGCGCCCTCGGCGTCTTCT
TCGACTCCGACGTTGGTCTCGCCGGCCCTGCCGTTGGCGAGCCGCCCGCTACCAAGCTCTTTGTCCTCCTGGGCG
GCCACTACTACGGCGGCGACGAGAGCCGAGGCCAGGTCCAGCCCCCGTCCGCCCCGCAGGCTGTCGCCCAGGCCA
AGGCGGTCCTCGAGCGCCACTTGGCCATTCCTCGCCACACGCCCTGCTTTGCCATGGCCCGCCCTGCCTGGAACT
GCATCCCGCAGCACACGCTTGGCCACGGCCAGCGCATGCGCACTGCCCACCACGAGCTCCACGCCGCCTTTGGAG
GCCGTCTCACCGTGGCCGGAGGCTCCTACTCCCGCATCGGCGTCATGGGCGCCCTCCGCGCAGGCTATGACGCTG
CCCGACGCATCACTGACAGCGCCGCCGCCACGGGGCTCGAGAGATTTGTCGACCCGGACCCCTTGGCCAACATTG
TTGCCGTGCCCAAGTCCAAGCTGGCCCCCGTGCGCGCCTTGAAGCCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail