Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3048
Gene name
LocationContig_2:386285..386716
Strand+
Gene length (bp)431
Transcript length (bp)324
Coding sequence length (bp)324
Protein length (aa) 108

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09446 VMA21 VMA21-like domain 8.0E-15 33 88

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S158|VMA21_NEUCR Vacuolar ATPase assembly integral membrane protein vma-21 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=vma-21 PE=3 SV=1 1 95 1.0E-41
sp|Q2HDV5|VMA21_CHAGB Vacuolar ATPase assembly integral membrane protein VMA21 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=VMA21 PE=3 SV=1 1 95 1.0E-40
sp|B2WDD8|VMA21_PYRTR Vacuolar ATPase assembly integral membrane protein vma21 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=vma21 PE=3 SV=1 1 94 2.0E-35
sp|A4R0J5|VMA21_MAGO7 Vacuolar ATPase assembly integral membrane protein VMA21 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=VMA21 PE=3 SV=1 1 107 5.0E-35
sp|Q0UV26|VMA21_PHANO Vacuolar ATPase assembly integral membrane protein VMA21 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=VMA21 PE=3 SV=1 1 105 1.0E-31
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S158|VMA21_NEUCR Vacuolar ATPase assembly integral membrane protein vma-21 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=vma-21 PE=3 SV=1 1 95 1.0E-41
sp|Q2HDV5|VMA21_CHAGB Vacuolar ATPase assembly integral membrane protein VMA21 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=VMA21 PE=3 SV=1 1 95 1.0E-40
sp|B2WDD8|VMA21_PYRTR Vacuolar ATPase assembly integral membrane protein vma21 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=vma21 PE=3 SV=1 1 94 2.0E-35
sp|A4R0J5|VMA21_MAGO7 Vacuolar ATPase assembly integral membrane protein VMA21 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=VMA21 PE=3 SV=1 1 107 5.0E-35
sp|Q0UV26|VMA21_PHANO Vacuolar ATPase assembly integral membrane protein VMA21 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=VMA21 PE=3 SV=1 1 105 1.0E-31
sp|A7F5K4|VMA21_SCLS1 Vacuolar ATPase assembly integral membrane protein vma21 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=vma21 PE=3 SV=1 22 93 3.0E-31
sp|A6R3V7|VMA21_AJECN Vacuolar ATPase assembly integral membrane protein VMA21 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=VMA21 PE=3 SV=1 1 94 3.0E-20
sp|Q5B905|VMA21_EMENI Vacuolar ATPase assembly integral membrane protein vma21 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=vma21 PE=3 SV=2 1 95 1.0E-18
sp|Q0CXF5|VMA21_ASPTN Vacuolar ATPase assembly integral membrane protein vma21 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=vma21 PE=3 SV=1 1 95 3.0E-18
sp|A1CJW1|VMA21_ASPCL Vacuolar ATPase assembly integral membrane protein vma21 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=vma21 PE=3 SV=1 24 107 8.0E-18
sp|Q1DPX9|VMA21_COCIM Vacuolar ATPase assembly integral membrane protein VMA21 OS=Coccidioides immitis (strain RS) GN=VMA21 PE=3 SV=1 16 94 2.0E-17
sp|A1D7K7|VMA21_NEOFI Vacuolar ATPase assembly integral membrane protein vma21 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=vma21 PE=3 SV=1 1 95 1.0E-16
sp|B0XYF0|VMA21_ASPFC Vacuolar ATPase assembly integral membrane protein vma21 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=vma21 PE=3 SV=1 1 107 1.0E-15
sp|Q4WX68|VMA21_ASPFU Vacuolar ATPase assembly integral membrane protein vma21 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=vma21 PE=3 SV=1 1 107 1.0E-15
sp|A3LU53|VMA21_PICST Vacuolar ATPase assembly integral membrane protein VMA21 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=VMA21 PE=3 SV=2 30 106 1.0E-14
sp|Q6BXM0|VMA21_DEBHA Vacuolar ATPase assembly integral membrane protein VMA21 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=VMA21 PE=3 SV=1 30 107 4.0E-14
sp|B4UN04|VMA21_CANGA Vacuolar ATPase assembly integral membrane protein VMA21 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=VMA21 PE=3 SV=1 30 106 1.0E-13
sp|C6Y4C8|VMA21_SCHPO Vacuolar ATPase assembly integral membrane protein vma21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vma21 PE=3 SV=1 21 102 7.0E-13
sp|Q75EI3|VMA21_ASHGO Vacuolar ATPase assembly integral membrane protein VMA21 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=VMA21 PE=3 SV=1 30 107 7.0E-13
sp|P41806|VMA21_YEAST Vacuolar ATPase assembly integral membrane protein VMA21 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VMA21 PE=1 SV=1 30 94 1.0E-11
sp|A6ZV87|VMA21_YEAS7 Vacuolar ATPase assembly integral membrane protein VMA21 OS=Saccharomyces cerevisiae (strain YJM789) GN=VMA21 PE=3 SV=1 30 94 1.0E-11
sp|B3LIC1|VMA21_YEAS1 Vacuolar ATPase assembly integral membrane protein VMA21 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=VMA21 PE=3 SV=1 30 94 1.0E-11
sp|Q6CDK3|VMA21_YARLI Vacuolar ATPase assembly integral membrane protein VMA21 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=VMA21 PE=3 SV=1 30 91 5.0E-09
sp|A5DGY3|VMA21_PICGU Vacuolar ATPase assembly integral membrane protein VMA21 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=VMA21 PE=3 SV=1 34 107 5.0E-08
sp|P0CS24|VMA21_CRYNJ Vacuolar ATPase assembly integral membrane protein VMA21 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=VMA21 PE=3 SV=1 23 97 1.0E-07
sp|P0CS25|VMA21_CRYNB Vacuolar ATPase assembly integral membrane protein VMA21 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=VMA21 PE=3 SV=1 23 97 1.0E-07
sp|Q6CQP9|VMA21_KLULA Vacuolar ATPase assembly integral membrane protein VMA21 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=VMA21 PE=3 SV=2 30 87 3.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0070072 vacuolar proton-transporting V-type ATPase complex assembly Yes
GO:0071840 cellular component organization or biogenesis No
GO:0009987 cellular process No
GO:0008150 biological_process No
GO:0016043 cellular component organization No
GO:0070071 proton-transporting two-sector ATPase complex assembly No
GO:0070070 proton-transporting V-type ATPase complex assembly No
GO:0043933 protein-containing complex organization No
GO:0065003 protein-containing complex assembly No
GO:0022607 cellular component assembly No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.5

Transmembrane Domains

Domain # Start End Length
1 35 57 22
2 67 86 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3048
MATRRIVSSEKSLVEHHDQSEQKSNISPAVPTHVIVKLLAFTFAMIVVPIGSYFLTINSLFKGNSSYAGALAALL
ANVVLIAYIVVAMNEDTSEKGPSLAAESKKNQ*
Coding >OphauB2|3048
ATGGCCACTCGACGCATCGTGAGCTCTGAAAAGTCCCTTGTGGAACACCATGATCAGTCTGAGCAAAAGTCCAAC
ATCAGCCCTGCCGTTCCAACTCACGTCATTGTTAAGCTCCTCGCCTTCACTTTTGCCATGATTGTTGTCCCCATT
GGATCCTATTTCCTCACCATTAATTCCCTCTTCAAAGGCAACTCCTCATACGCTGGTGCCCTTGCCGCGCTACTA
GCAAACGTGGTTCTCATTGCTTACATTGTCGTCGCCATGAATGAGGATACCTCGGAAAAAGGGCCATCTTTGGCG
GCCGAGAGCAAAAAAAACCAATGA
Transcript >OphauB2|3048
ATGGCCACTCGACGCATCGTGAGCTCTGAAAAGTCCCTTGTGGAACACCATGATCAGTCTGAGCAAAAGTCCAAC
ATCAGCCCTGCCGTTCCAACTCACGTCATTGTTAAGCTCCTCGCCTTCACTTTTGCCATGATTGTTGTCCCCATT
GGATCCTATTTCCTCACCATTAATTCCCTCTTCAAAGGCAACTCCTCATACGCTGGTGCCCTTGCCGCGCTACTA
GCAAACGTGGTTCTCATTGCTTACATTGTCGTCGCCATGAATGAGGATACCTCGGAAAAAGGGCCATCTTTGGCG
GCCGAGAGCAAAAAAAACCAATGA
Gene >OphauB2|3048
ATGGCCACTCGACGCATCGTGAGCTCTGAAAAGTCCCTTGTGGAACACCATGATCAGTCTGAGCAAAAGTCCAAC
ATCAGCCCTGCCGTTCCAACGTGTGTTGCTCCCTCGCCGCCATTTCCACCACTCCTAAACGTTAACTCGCACCTA
GTCACGTCATTGTTAAGCTCCTCGCCTTCACTTTTGCCATGATTGTTGTCCCCATTGGATCCTATTTCCTCACCA
TTAATTCCCTCTTCAAAGGCATGATGAGCCTTTGCTTCTCCGTCTTTTTTCATCTACTAACTATCCTAGGCAACT
CCTCATACGCTGGTGCCCTTGCCGCGCTACTAGCAAACGTGGTTCTCATTGCTTACATTGTCGTCGCCATGAATG
AGGATACCTCGGAAAAAGGGCCATCTTTGGCGGCCGAGAGCAAAAAAAACCAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail