Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3046
Gene name
LocationContig_2:379744..382070
Strand+
Gene length (bp)2326
Transcript length (bp)2250
Coding sequence length (bp)2250
Protein length (aa) 750

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08238 Sel1 Sel1 repeat 1.2E-01 448 484
PF08238 Sel1 Sel1 repeat 8.9E-06 485 518
PF08238 Sel1 Sel1 repeat 5.5E-02 522 554
PF08238 Sel1 Sel1 repeat 7.3E-05 564 597
PF08238 Sel1 Sel1 repeat 3.8E-04 598 634
PF08238 Sel1 Sel1 repeat 1.7E-03 635 672
PF08238 Sel1 Sel1 repeat 7.2E-05 673 708

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P34226|SKT5_YEAST Protein SKT5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKT5 PE=1 SV=1 357 715 1.0E-85
sp|Q09897|CHR3_SCHPO Chitin synthase regulatory factor 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chr3 PE=1 SV=1 447 749 1.0E-45
sp|A6ZR53|SHC1_YEAS7 Protein SHC1 OS=Saccharomyces cerevisiae (strain YJM789) GN=SHC1 PE=3 SV=1 357 600 3.0E-40
sp|P39000|SHC1_YEAST Protein SHC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SHC1 PE=2 SV=1 357 600 8.0E-40
sp|Q07622|ACK1_YEAST Activator of C kinase protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACK1 PE=1 SV=1 370 715 3.0E-26
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P34226|SKT5_YEAST Protein SKT5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKT5 PE=1 SV=1 357 715 1.0E-85
sp|Q09897|CHR3_SCHPO Chitin synthase regulatory factor 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chr3 PE=1 SV=1 447 749 1.0E-45
sp|A6ZR53|SHC1_YEAS7 Protein SHC1 OS=Saccharomyces cerevisiae (strain YJM789) GN=SHC1 PE=3 SV=1 357 600 3.0E-40
sp|P39000|SHC1_YEAST Protein SHC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SHC1 PE=2 SV=1 357 600 8.0E-40
sp|Q07622|ACK1_YEAST Activator of C kinase protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACK1 PE=1 SV=1 370 715 3.0E-26
sp|O94486|CHR2_SCHPO Chitin synthase regulatory factor 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chr2 PE=3 SV=1 445 695 4.0E-21
sp|O94614|CHR4_SCHPO Chitin synthase regulatory factor 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chr4 PE=1 SV=4 413 719 6.0E-21
sp|O59732|CHR1_SCHPO Chitin synthase regulatory factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chr1 PE=1 SV=1 535 693 2.0E-20
sp|P77234|YBEQ_ECOLI Uncharacterized protein YbeQ OS=Escherichia coli (strain K12) GN=ybeQ PE=4 SV=2 472 731 4.0E-18
sp|A0A0H2VDN9|ESIB_ECOL6 Secretory immunoglobulin A-binding protein EsiB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=esiB PE=1 SV=1 387 718 5.0E-13
sp|Q14154|DELE_HUMAN Death ligand signal enhancer OS=Homo sapiens GN=KIAA0141 PE=1 SV=3 468 649 1.0E-11
sp|Q9LM25|HRD3A_ARATH ERAD-associated E3 ubiquitin-protein ligase component HRD3A OS=Arabidopsis thaliana GN=HRD3A PE=1 SV=1 463 676 2.0E-11
sp|Q10NT7|HRD3_ORYSJ ERAD-associated E3 ubiquitin-protein ligase component HRD3 OS=Oryza sativa subsp. japonica GN=HRD3 PE=2 SV=1 463 717 2.0E-09
sp|P60924|DELE_RAT Death ligand signal enhancer OS=Rattus norvegicus GN=Dele PE=2 SV=1 468 649 2.0E-09
sp|A0A0H2VDN9|ESIB_ECOL6 Secretory immunoglobulin A-binding protein EsiB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=esiB PE=1 SV=1 468 718 3.0E-09
sp|Q9DCV6|DELE_MOUSE Death ligand signal enhancer OS=Mus musculus GN=Kiaa0141 PE=2 SV=1 468 649 5.0E-09
sp|Q9DCV6|DELE_MOUSE Death ligand signal enhancer OS=Mus musculus GN=Kiaa0141 PE=2 SV=1 553 718 1.0E-08
sp|P60924|DELE_RAT Death ligand signal enhancer OS=Rattus norvegicus GN=Dele PE=2 SV=1 553 718 4.0E-08
sp|Q9ZG88|PODJ_CAUCR Localization factor PodJL OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=podJ PE=1 SV=2 587 720 6.0E-08
sp|B8GXA0|PODJ_CAUCN Localization factor PodJL OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=podJ PE=2 SV=1 587 720 6.0E-08
sp|P77296|YBET_ECOLI Uncharacterized protein YbeT OS=Escherichia coli (strain K12) GN=ybeT PE=2 SV=1 590 716 2.0E-07
sp|Q9UBV2|SE1L1_HUMAN Protein sel-1 homolog 1 OS=Homo sapiens GN=SEL1L PE=1 SV=3 431 724 6.0E-07
sp|Q9ESM7|SE1L1_MESAU Protein sel-1 homolog 1 OS=Mesocricetus auratus GN=Sel1l PE=2 SV=1 508 724 8.0E-07
sp|Q5TEA6|SE1L2_HUMAN Protein sel-1 homolog 2 OS=Homo sapiens GN=SEL1L2 PE=1 SV=2 472 705 1.0E-06
sp|Q3V172|SE1L2_MOUSE Protein sel-1 homolog 2 OS=Mus musculus GN=Sel1l2 PE=2 SV=1 433 724 1.0E-06
sp|Q14154|DELE_HUMAN Death ligand signal enhancer OS=Homo sapiens GN=KIAA0141 PE=1 SV=3 553 731 2.0E-06
sp|Q3V172|SE1L2_MOUSE Protein sel-1 homolog 2 OS=Mus musculus GN=Sel1l2 PE=2 SV=1 472 735 2.0E-06
sp|Q94C27|FB84_ARATH F-box protein At1g70590 OS=Arabidopsis thaliana GN=At1g70590 PE=2 SV=1 622 741 2.0E-06
sp|Q80Z70|SE1L1_RAT Protein sel-1 homolog 1 OS=Rattus norvegicus GN=Sel1l PE=2 SV=2 431 724 2.0E-06
sp|Q5TEA6|SE1L2_HUMAN Protein sel-1 homolog 2 OS=Homo sapiens GN=SEL1L2 PE=1 SV=2 433 724 3.0E-06
sp|Q9Z2G6|SE1L1_MOUSE Protein sel-1 homolog 1 OS=Mus musculus GN=Sel1l PE=1 SV=2 431 724 3.0E-06
sp|Q5XI05|SE1L2_RAT Protein sel-1 homolog 2 OS=Rattus norvegicus GN=Sel1l2 PE=2 SV=1 433 724 6.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4454
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1849
Ophiocordyceps australis map64 (Brazil) OphauB2|3046 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|04403
Ophiocordyceps camponoti-rufipedis Ophun1|7166
Ophiocordyceps kimflemingae Ophio5|3133
Ophiocordyceps subramaniannii Hirsu2|9245

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3046
MSSTTTASRNHDSLRSMPPAGARSSHRVPRKPLVQSNAPANRTQLRDGSLCPAESKYQDDGCAPLSRINVESRVR
AANKLSKALPKLPLARDAVFDSGDKGFMVASPSLALDGDEMTLSRGRRCSTDNAIEFDDVGANSNLGAASTPGQL
DATAVSPYKQGLRGVFRNSRESDETASSGHQAGSVHSSAPTSTSSVYGSNDATECSPHQLSPQGSVLDGRQGQIE
SIPQFHYHHQRDYSPRPSNGNPDAARPSLTPDQLDSTAHGGRHLTPLSGYFGRASQSRPQSSYSLWSENAPRGPS
PNLSPRGSHLRAPSLQSRKSPDARPSSYAELLNVPYPQQAPAPLTLDNSNLRSAVGNNASLLSTQKTLDMYRQNV
KKTNDFSIQYSFAVFLISTAQELGLDMADAMARKPSPHPPRDLDSSCFTANPFEMVREARQILQRLANGGYPFAQ
YYLADGFASGLFSKGKEDYNAAFPLFVLAAKHGHAESAYRAALCYEFGWGCRKDPAKAVQFLRLAASKRHPGAMT
RLGKACLSGDLGEKRYREGIKWLKLATEAADAQYNNAPYQLGCLYETGYGDDVFEDLSYAAELYTQAAELGHPEA
NYRMGEAYEHGTLNCPKDAALSVHFYTGAAERGHAAAMMGLCAWYMVGAPPIMDKDEEEAYEWARRSAQLGYAKA
QYAVGYFTEMGIGCRRDMLEANVWYVKAADAGDERARQRLAVIQAAASGGGMPMDVAPPRNAKMAKDDKDCVVM*
Coding >OphauB2|3046
ATGTCTTCAACAACCACTGCAAGTAGAAATCACGACTCGCTGCGCTCCATGCCACCTGCTGGTGCTAGATCGTCT
CACAGGGTCCCTCGCAAACCTCTGGTGCAATCAAACGCACCGGCAAACAGGACTCAGCTCCGTGATGGCTCTCTA
TGCCCCGCCGAGTCGAAATACCAAGACGACGGCTGCGCCCCTTTATCCAGAATCAATGTCGAGTCGCGCGTGCGA
GCAGCCAACAAGCTTTCCAAGGCATTGCCCAAGCTGCCCTTGGCTCGCGATGCAGTGTTTGACTCGGGCGATAAA
GGATTCATGGTTGCTTCGCCGTCGCTGGCACTTGATGGCGATGAGATGACGCTGTCACGGGGCAGACGCTGCAGC
ACGGATAATGCGATAGAGTTTGATGACGTGGGCGCCAATTCAAACCTTGGTGCGGCTTCAACGCCTGGCCAGTTG
GATGCAACGGCCGTTAGCCCCTACAAACAAGGGCTCCGGGGTGTCTTTCGCAACAGCCGCGAATCAGACGAGACA
GCCAGCAGCGGGCACCAAGCAGGCTCTGTTCATTCCTCGGCTCCAACAAGCACGAGCTCCGTCTATGGTAGCAAT
GATGCCACCGAGTGCTCGCCCCATCAGCTCTCTCCCCAAGGCTCGGTGCTCGACGGCAGACAAGGGCAAATAGAA
AGCATTCCGCAGTTCCATTATCACCACCAACGAGACTACTCGCCGCGCCCTAGCAATGGCAACCCGGACGCGGCC
CGGCCATCTCTCACTCCAGATCAGCTCGATAGCACTGCACACGGGGGCCGCCACCTGACGCCCTTGTCGGGCTAC
TTTGGCAGAGCCTCTCAGTCGCGGCCGCAGTCGTCGTACTCTTTGTGGTCGGAAAATGCCCCTCGGGGCCCGTCT
CCCAATCTTTCGCCCCGAGGCTCGCACTTGCGCGCCCCCTCGTTGCAGTCGCGCAAGTCTCCAGATGCCAGACCC
TCGTCGTACGCCGAGCTGCTCAATGTGCCCTATCCACAACAAGCCCCGGCGCCTCTCACTCTGGACAACTCCAAC
TTGCGCAGCGCCGTGGGCAACAACGCATCGCTCCTCAGCACGCAAAAGACGCTTGACATGTACCGCCAAAACGTC
AAAAAGACAAACGACTTCTCCATCCAGTACTCGTTTGCCGTATTCCTCATCTCCACAGCACAGGAGCTGGGACTC
GACATGGCCGACGCCATGGCGCGCAAGCCCAGCCCACACCCCCCTCGCGACTTGGACAGCTCGTGCTTCACTGCC
AATCCCTTTGAGATGGTGCGAGAGGCTCGCCAGATCCTGCAGCGCCTTGCCAACGGCGGATACCCCTTTGCTCAG
TACTACCTGGCCGACGGCTTTGCCTCGGGGCTCTTTAGCAAAGGCAAAGAGGACTACAATGCCGCCTTTCCGCTC
TTTGTCCTTGCCGCAAAGCACGGGCATGCCGAGTCTGCATATCGTGCGGCTCTTTGCTACGAGTTTGGCTGGGGC
TGCCGCAAGGACCCGGCAAAGGCGGTGCAGTTCTTGCGCCTGGCAGCCTCGAAGCGTCATCCCGGGGCCATGACG
CGCCTGGGCAAAGCGTGTCTGTCGGGCGACTTGGGCGAAAAGAGATATCGTGAGGGCATCAAGTGGCTCAAGCTA
GCGACCGAGGCAGCCGACGCCCAGTACAACAATGCTCCCTACCAGCTGGGGTGCCTGTATGAGACGGGATACGGG
GACGATGTTTTTGAGGACCTGAGCTACGCGGCCGAGCTCTATACACAGGCGGCCGAGCTGGGCCACCCCGAGGCC
AACTACCGCATGGGCGAGGCCTATGAACACGGCACTCTCAACTGCCCCAAGGATGCGGCGCTGAGTGTGCACTTT
TATACCGGCGCTGCTGAGCGCGGGCACGCAGCCGCCATGATGGGTCTCTGCGCCTGGTACATGGTTGGAGCACCG
CCCATTATGGACAAGGACGAGGAAGAGGCGTATGAATGGGCTCGCCGCTCGGCCCAACTTGGCTACGCCAAGGCT
CAATATGCTGTCGGCTACTTTACCGAGATGGGCATTGGCTGCCGGCGCGACATGCTCGAGGCCAACGTGTGGTAC
GTCAAGGCAGCCGATGCTGGCGACGAGCGAGCCAGACAGCGGCTGGCCGTCATTCAAGCGGCAGCCAGTGGCGGC
GGCATGCCCATGGACGTTGCGCCGCCTCGCAACGCCAAGATGGCCAAGGACGACAAGGACTGCGTGGTAATGTGA
Transcript >OphauB2|3046
ATGTCTTCAACAACCACTGCAAGTAGAAATCACGACTCGCTGCGCTCCATGCCACCTGCTGGTGCTAGATCGTCT
CACAGGGTCCCTCGCAAACCTCTGGTGCAATCAAACGCACCGGCAAACAGGACTCAGCTCCGTGATGGCTCTCTA
TGCCCCGCCGAGTCGAAATACCAAGACGACGGCTGCGCCCCTTTATCCAGAATCAATGTCGAGTCGCGCGTGCGA
GCAGCCAACAAGCTTTCCAAGGCATTGCCCAAGCTGCCCTTGGCTCGCGATGCAGTGTTTGACTCGGGCGATAAA
GGATTCATGGTTGCTTCGCCGTCGCTGGCACTTGATGGCGATGAGATGACGCTGTCACGGGGCAGACGCTGCAGC
ACGGATAATGCGATAGAGTTTGATGACGTGGGCGCCAATTCAAACCTTGGTGCGGCTTCAACGCCTGGCCAGTTG
GATGCAACGGCCGTTAGCCCCTACAAACAAGGGCTCCGGGGTGTCTTTCGCAACAGCCGCGAATCAGACGAGACA
GCCAGCAGCGGGCACCAAGCAGGCTCTGTTCATTCCTCGGCTCCAACAAGCACGAGCTCCGTCTATGGTAGCAAT
GATGCCACCGAGTGCTCGCCCCATCAGCTCTCTCCCCAAGGCTCGGTGCTCGACGGCAGACAAGGGCAAATAGAA
AGCATTCCGCAGTTCCATTATCACCACCAACGAGACTACTCGCCGCGCCCTAGCAATGGCAACCCGGACGCGGCC
CGGCCATCTCTCACTCCAGATCAGCTCGATAGCACTGCACACGGGGGCCGCCACCTGACGCCCTTGTCGGGCTAC
TTTGGCAGAGCCTCTCAGTCGCGGCCGCAGTCGTCGTACTCTTTGTGGTCGGAAAATGCCCCTCGGGGCCCGTCT
CCCAATCTTTCGCCCCGAGGCTCGCACTTGCGCGCCCCCTCGTTGCAGTCGCGCAAGTCTCCAGATGCCAGACCC
TCGTCGTACGCCGAGCTGCTCAATGTGCCCTATCCACAACAAGCCCCGGCGCCTCTCACTCTGGACAACTCCAAC
TTGCGCAGCGCCGTGGGCAACAACGCATCGCTCCTCAGCACGCAAAAGACGCTTGACATGTACCGCCAAAACGTC
AAAAAGACAAACGACTTCTCCATCCAGTACTCGTTTGCCGTATTCCTCATCTCCACAGCACAGGAGCTGGGACTC
GACATGGCCGACGCCATGGCGCGCAAGCCCAGCCCACACCCCCCTCGCGACTTGGACAGCTCGTGCTTCACTGCC
AATCCCTTTGAGATGGTGCGAGAGGCTCGCCAGATCCTGCAGCGCCTTGCCAACGGCGGATACCCCTTTGCTCAG
TACTACCTGGCCGACGGCTTTGCCTCGGGGCTCTTTAGCAAAGGCAAAGAGGACTACAATGCCGCCTTTCCGCTC
TTTGTCCTTGCCGCAAAGCACGGGCATGCCGAGTCTGCATATCGTGCGGCTCTTTGCTACGAGTTTGGCTGGGGC
TGCCGCAAGGACCCGGCAAAGGCGGTGCAGTTCTTGCGCCTGGCAGCCTCGAAGCGTCATCCCGGGGCCATGACG
CGCCTGGGCAAAGCGTGTCTGTCGGGCGACTTGGGCGAAAAGAGATATCGTGAGGGCATCAAGTGGCTCAAGCTA
GCGACCGAGGCAGCCGACGCCCAGTACAACAATGCTCCCTACCAGCTGGGGTGCCTGTATGAGACGGGATACGGG
GACGATGTTTTTGAGGACCTGAGCTACGCGGCCGAGCTCTATACACAGGCGGCCGAGCTGGGCCACCCCGAGGCC
AACTACCGCATGGGCGAGGCCTATGAACACGGCACTCTCAACTGCCCCAAGGATGCGGCGCTGAGTGTGCACTTT
TATACCGGCGCTGCTGAGCGCGGGCACGCAGCCGCCATGATGGGTCTCTGCGCCTGGTACATGGTTGGAGCACCG
CCCATTATGGACAAGGACGAGGAAGAGGCGTATGAATGGGCTCGCCGCTCGGCCCAACTTGGCTACGCCAAGGCT
CAATATGCTGTCGGCTACTTTACCGAGATGGGCATTGGCTGCCGGCGCGACATGCTCGAGGCCAACGTGTGGTAC
GTCAAGGCAGCCGATGCTGGCGACGAGCGAGCCAGACAGCGGCTGGCCGTCATTCAAGCGGCAGCCAGTGGCGGC
GGCATGCCCATGGACGTTGCGCCGCCTCGCAACGCCAAGATGGCCAAGGACGACAAGGACTGCGTGGTAATGTGA
Gene >OphauB2|3046
ATGTCTTCAACAACCACTGCAAGTAGAAATCACGACTCGCTGCGCTCCATGCCACCTGCTGGTGCTAGATCGTCT
CACAGGGTCCCTCGCAAACCTCTGGTGCAATCAAACGCACCGGCAAACAGGACTCAGCTCCGTGATGGCTCTCTA
TGCCCCGCCGAGTCGAAATACCAAGACGACGGCTGCGCCCCTTTATCCAGAATCAATGTCGAGTCGCGCGTGCGA
GCAGCCAACAAGCTTTCCAAGGCATTGCCCAAGCTGCCCTTGGCTCGCGATGCAGTGTTTGACTCGGGCGATAAA
GGATTCATGGTTGCTTCGCCGTCGCTGGCACTTGATGGCGATGAGATGACGCTGTCACGGGGCAGACGCTGCAGC
ACGGATAATGCGATAGAGTTTGATGACGTGGGCGCCAATTCAAACCTTGGTGCGGCTTCAACGCCTGGCCAGTTG
GATGCAACGGCCGTTAGCCCCTACAAACAAGGGCTCCGGGGTGTCTTTCGCAACAGCCGCGAATCAGACGAGACA
GCCAGCAGCGGGCACCAAGCAGGCTCTGTTCATTCCTCGGCTCCAACAAGCACGAGCTCCGTCTATGGTAGCAAT
GATGCCACCGAGTGCTCGCCCCATCAGCTCTCTCCCCAAGGCTCGGTGCTCGACGGCAGACAAGGGCAAATAGAA
AGCATTCCGCAGTTCCATTATCACCACCAACGAGACTACTCGCCGCGCCCTAGCAATGGCAACCCGGACGCGGCC
CGGCCATCTCTCACTCCAGATCAGCTCGATAGCACTGCACACGGGGGCCGCCACCTGACGCCCTTGTCGGGCTAC
TTTGGCAGAGCCTCTCAGTCGCGGCCGCAGTCGTCGTACTCTTTGTGGTCGGAAAATGCCCCTCGGGGCCCGTCT
CCCAATCTTTCGCCCCGAGGCTCGCACTTGCGCGCCCCCTCGTTGCAGTCGCGCAAGTCTCCAGATGCCAGACCC
TCGTCGTACGCCGAGCTGCTCAATGTGCCCTATCCACAACAAGCCCCGGCGCCTCTCACTCTGGACAACTCCAAC
TTGCGCAGCGCCGTGGGCAACAACGCATCGCTCCTCAGCACGCAAAAGACGCTTGACATGTACCGCCAAAACGTC
AAAAAGACAAACGACTTCTCCATCCAGTACTCGTTTGCCGTATTCCTCATCTCCACAGCACAGGAGCTGGGACTC
GACATGGCCGACGCCATGGCGCGCAAGCCCAGCCCACACCCCCCTCGCGACTTGGACAGCTCGTGCTTCACTGCC
AATCCCTTTGAGATGGTGCGAGAGGCTCGCCAGATCCTGCAGCGCCTTGCCAACGGCGGATACCCCTTTGCTCAG
TACTACCTGGCCGACGGCTTTGCCTCGGGGCTCTTTAGCAAAGGCAAAGAGGACTACAATGCCGCCTTTCCGCTC
TTTGTCCTTGCCGCAAAGCACGGGCATGCCGAGTCTGCATATCGTGCGGCTCTTTGCTACGAGTTTGGCTGGGGC
TGCCGCAAGGACCCGGCAAAGGCGGTGCAGTTCTTGCGCCTGGCAGCCTCGAAGCGTCATCCCGGGGCCATGACG
CGCCTGGGCAAAGCGTGTCTGTCGGGCGACTTGGGCGAAAAGAGATATCGTGAGGGCATCAAGTGGCTCAAGCTA
GCGACCGAGGCAGCCGACGCCCAGTACAACAATGCTCCCTACCAGCTGGGGTGCCTGTATGAGACGGGATACGGG
GACGATGTTTTTGAGGACCTGAGCTACGCGGCCGAGCTCTATACACAGGCGGCCGAGCTGGGCCACCCCGAGGCC
AACTACCGCATGGGCGAGGCCTATGAACACGGCACTCTCAACTGCCCCAAGGATGCGGCGCTGAGTGTGCACTTT
TATACCGGCGCTGCTGAGCGCGGGCACGCAGCCGCCATGATGGGTCTCTGCGCCTGGTACATGGTTGGAGCACCG
CCCATTATGGACAAGGACGAGGAAGAGGCGTATGAATGGGCTCGCCGCTCGGCCCAACTTGGTATGTGGCAAAGG
GCAGCTTGCGTCGAGTCATGGGAGTGCTGACACGGTGCCTTTGCTGGCGGCGGGCATGGCAGGCTACGCCAAGGC
TCAATATGCTGTCGGCTACTTTACCGAGATGGGCATTGGCTGCCGGCGCGACATGCTCGAGGCCAACGTGTGGTA
CGTCAAGGCAGCCGATGCTGGCGACGAGCGAGCCAGACAGCGGCTGGCCGTCATTCAAGCGGCAGCCAGTGGCGG
CGGCATGCCCATGGACGTTGCGCCGCCTCGCAACGCCAAGATGGCCAAGGACGACAAGGACTGCGTGGTAATGTG
A

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail