Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3046
Gene name
LocationContig_2:379744..382070
Strand+
Gene length (bp)2326
Transcript length (bp)2250
Coding sequence length (bp)2250
Protein length (aa) 750

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08238 Sel1 Sel1 repeat 1.2E-01 448 484
PF08238 Sel1 Sel1 repeat 8.9E-06 485 518
PF08238 Sel1 Sel1 repeat 5.5E-02 522 554
PF08238 Sel1 Sel1 repeat 7.3E-05 564 597
PF08238 Sel1 Sel1 repeat 3.8E-04 598 634
PF08238 Sel1 Sel1 repeat 1.7E-03 635 672
PF08238 Sel1 Sel1 repeat 7.2E-05 673 708

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P34226|SKT5_YEAST Protein SKT5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKT5 PE=1 SV=1 357 715 1.0E-85
sp|Q09897|CHR3_SCHPO Chitin synthase regulatory factor 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chr3 PE=1 SV=1 447 749 1.0E-45
sp|A6ZR53|SHC1_YEAS7 Protein SHC1 OS=Saccharomyces cerevisiae (strain YJM789) GN=SHC1 PE=3 SV=1 357 600 3.0E-40
sp|P39000|SHC1_YEAST Protein SHC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SHC1 PE=2 SV=1 357 600 8.0E-40
sp|Q07622|ACK1_YEAST Activator of C kinase protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACK1 PE=1 SV=1 370 715 3.0E-26
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P34226|SKT5_YEAST Protein SKT5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKT5 PE=1 SV=1 357 715 1.0E-85
sp|Q09897|CHR3_SCHPO Chitin synthase regulatory factor 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chr3 PE=1 SV=1 447 749 1.0E-45
sp|A6ZR53|SHC1_YEAS7 Protein SHC1 OS=Saccharomyces cerevisiae (strain YJM789) GN=SHC1 PE=3 SV=1 357 600 3.0E-40
sp|P39000|SHC1_YEAST Protein SHC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SHC1 PE=2 SV=1 357 600 8.0E-40
sp|Q07622|ACK1_YEAST Activator of C kinase protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACK1 PE=1 SV=1 370 715 3.0E-26
sp|O94486|CHR2_SCHPO Chitin synthase regulatory factor 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chr2 PE=3 SV=1 445 695 4.0E-21
sp|O94614|CHR4_SCHPO Chitin synthase regulatory factor 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chr4 PE=1 SV=4 413 719 6.0E-21
sp|O59732|CHR1_SCHPO Chitin synthase regulatory factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chr1 PE=1 SV=1 535 693 2.0E-20
sp|P77234|YBEQ_ECOLI Uncharacterized protein YbeQ OS=Escherichia coli (strain K12) GN=ybeQ PE=4 SV=2 472 731 4.0E-18
sp|A0A0H2VDN9|ESIB_ECOL6 Secretory immunoglobulin A-binding protein EsiB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=esiB PE=1 SV=1 387 718 5.0E-13
sp|Q14154|DELE_HUMAN Death ligand signal enhancer OS=Homo sapiens GN=KIAA0141 PE=1 SV=3 468 649 1.0E-11
sp|Q9LM25|HRD3A_ARATH ERAD-associated E3 ubiquitin-protein ligase component HRD3A OS=Arabidopsis thaliana GN=HRD3A PE=1 SV=1 463 676 2.0E-11
sp|Q10NT7|HRD3_ORYSJ ERAD-associated E3 ubiquitin-protein ligase component HRD3 OS=Oryza sativa subsp. japonica GN=HRD3 PE=2 SV=1 463 717 2.0E-09
sp|P60924|DELE_RAT Death ligand signal enhancer OS=Rattus norvegicus GN=Dele PE=2 SV=1 468 649 2.0E-09
sp|A0A0H2VDN9|ESIB_ECOL6 Secretory immunoglobulin A-binding protein EsiB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=esiB PE=1 SV=1 468 718 3.0E-09
sp|Q9DCV6|DELE_MOUSE Death ligand signal enhancer OS=Mus musculus GN=Kiaa0141 PE=2 SV=1 468 649 5.0E-09
sp|Q9DCV6|DELE_MOUSE Death ligand signal enhancer OS=Mus musculus GN=Kiaa0141 PE=2 SV=1 553 718 1.0E-08
sp|P60924|DELE_RAT Death ligand signal enhancer OS=Rattus norvegicus GN=Dele PE=2 SV=1 553 718 4.0E-08
sp|Q9ZG88|PODJ_CAUCR Localization factor PodJL OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=podJ PE=1 SV=2 587 720 6.0E-08
sp|B8GXA0|PODJ_CAUCN Localization factor PodJL OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=podJ PE=2 SV=1 587 720 6.0E-08
sp|P77296|YBET_ECOLI Uncharacterized protein YbeT OS=Escherichia coli (strain K12) GN=ybeT PE=2 SV=1 590 716 2.0E-07
sp|Q9UBV2|SE1L1_HUMAN Protein sel-1 homolog 1 OS=Homo sapiens GN=SEL1L PE=1 SV=3 431 724 6.0E-07
sp|Q9ESM7|SE1L1_MESAU Protein sel-1 homolog 1 OS=Mesocricetus auratus GN=Sel1l PE=2 SV=1 508 724 8.0E-07
sp|Q5TEA6|SE1L2_HUMAN Protein sel-1 homolog 2 OS=Homo sapiens GN=SEL1L2 PE=1 SV=2 472 705 1.0E-06
sp|Q3V172|SE1L2_MOUSE Protein sel-1 homolog 2 OS=Mus musculus GN=Sel1l2 PE=2 SV=1 433 724 1.0E-06
sp|Q14154|DELE_HUMAN Death ligand signal enhancer OS=Homo sapiens GN=KIAA0141 PE=1 SV=3 553 731 2.0E-06
sp|Q3V172|SE1L2_MOUSE Protein sel-1 homolog 2 OS=Mus musculus GN=Sel1l2 PE=2 SV=1 472 735 2.0E-06
sp|Q94C27|FB84_ARATH F-box protein At1g70590 OS=Arabidopsis thaliana GN=At1g70590 PE=2 SV=1 622 741 2.0E-06
sp|Q80Z70|SE1L1_RAT Protein sel-1 homolog 1 OS=Rattus norvegicus GN=Sel1l PE=2 SV=2 431 724 2.0E-06
sp|Q5TEA6|SE1L2_HUMAN Protein sel-1 homolog 2 OS=Homo sapiens GN=SEL1L2 PE=1 SV=2 433 724 3.0E-06
sp|Q9Z2G6|SE1L1_MOUSE Protein sel-1 homolog 1 OS=Mus musculus GN=Sel1l PE=1 SV=2 431 724 3.0E-06
sp|Q5XI05|SE1L2_RAT Protein sel-1 homolog 2 OS=Rattus norvegicus GN=Sel1l2 PE=2 SV=1 433 724 6.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3046
MSSTTTASRNHDSLRSMPPAGARSSHRVPRKPLVQSNAPANRTQLRDGSLCPAESKYQDDGCAPLSRINVESRVR
AANKLSKALPKLPLARDAVFDSGDKGFMVASPSLALDGDEMTLSRGRRCSTDNAIEFDDVGANSNLGAASTPGQL
DATAVSPYKQGLRGVFRNSRESDETASSGHQAGSVHSSAPTSTSSVYGSNDATECSPHQLSPQGSVLDGRQGQIE
SIPQFHYHHQRDYSPRPSNGNPDAARPSLTPDQLDSTAHGGRHLTPLSGYFGRASQSRPQSSYSLWSENAPRGPS
PNLSPRGSHLRAPSLQSRKSPDARPSSYAELLNVPYPQQAPAPLTLDNSNLRSAVGNNASLLSTQKTLDMYRQNV
KKTNDFSIQYSFAVFLISTAQELGLDMADAMARKPSPHPPRDLDSSCFTANPFEMVREARQILQRLANGGYPFAQ
YYLADGFASGLFSKGKEDYNAAFPLFVLAAKHGHAESAYRAALCYEFGWGCRKDPAKAVQFLRLAASKRHPGAMT
RLGKACLSGDLGEKRYREGIKWLKLATEAADAQYNNAPYQLGCLYETGYGDDVFEDLSYAAELYTQAAELGHPEA
NYRMGEAYEHGTLNCPKDAALSVHFYTGAAERGHAAAMMGLCAWYMVGAPPIMDKDEEEAYEWARRSAQLGYAKA
QYAVGYFTEMGIGCRRDMLEANVWYVKAADAGDERARQRLAVIQAAASGGGMPMDVAPPRNAKMAKDDKDCVVM*
Coding >OphauB2|3046
ATGTCTTCAACAACCACTGCAAGTAGAAATCACGACTCGCTGCGCTCCATGCCACCTGCTGGTGCTAGATCGTCT
CACAGGGTCCCTCGCAAACCTCTGGTGCAATCAAACGCACCGGCAAACAGGACTCAGCTCCGTGATGGCTCTCTA
TGCCCCGCCGAGTCGAAATACCAAGACGACGGCTGCGCCCCTTTATCCAGAATCAATGTCGAGTCGCGCGTGCGA
GCAGCCAACAAGCTTTCCAAGGCATTGCCCAAGCTGCCCTTGGCTCGCGATGCAGTGTTTGACTCGGGCGATAAA
GGATTCATGGTTGCTTCGCCGTCGCTGGCACTTGATGGCGATGAGATGACGCTGTCACGGGGCAGACGCTGCAGC
ACGGATAATGCGATAGAGTTTGATGACGTGGGCGCCAATTCAAACCTTGGTGCGGCTTCAACGCCTGGCCAGTTG
GATGCAACGGCCGTTAGCCCCTACAAACAAGGGCTCCGGGGTGTCTTTCGCAACAGCCGCGAATCAGACGAGACA
GCCAGCAGCGGGCACCAAGCAGGCTCTGTTCATTCCTCGGCTCCAACAAGCACGAGCTCCGTCTATGGTAGCAAT
GATGCCACCGAGTGCTCGCCCCATCAGCTCTCTCCCCAAGGCTCGGTGCTCGACGGCAGACAAGGGCAAATAGAA
AGCATTCCGCAGTTCCATTATCACCACCAACGAGACTACTCGCCGCGCCCTAGCAATGGCAACCCGGACGCGGCC
CGGCCATCTCTCACTCCAGATCAGCTCGATAGCACTGCACACGGGGGCCGCCACCTGACGCCCTTGTCGGGCTAC
TTTGGCAGAGCCTCTCAGTCGCGGCCGCAGTCGTCGTACTCTTTGTGGTCGGAAAATGCCCCTCGGGGCCCGTCT
CCCAATCTTTCGCCCCGAGGCTCGCACTTGCGCGCCCCCTCGTTGCAGTCGCGCAAGTCTCCAGATGCCAGACCC
TCGTCGTACGCCGAGCTGCTCAATGTGCCCTATCCACAACAAGCCCCGGCGCCTCTCACTCTGGACAACTCCAAC
TTGCGCAGCGCCGTGGGCAACAACGCATCGCTCCTCAGCACGCAAAAGACGCTTGACATGTACCGCCAAAACGTC
AAAAAGACAAACGACTTCTCCATCCAGTACTCGTTTGCCGTATTCCTCATCTCCACAGCACAGGAGCTGGGACTC
GACATGGCCGACGCCATGGCGCGCAAGCCCAGCCCACACCCCCCTCGCGACTTGGACAGCTCGTGCTTCACTGCC
AATCCCTTTGAGATGGTGCGAGAGGCTCGCCAGATCCTGCAGCGCCTTGCCAACGGCGGATACCCCTTTGCTCAG
TACTACCTGGCCGACGGCTTTGCCTCGGGGCTCTTTAGCAAAGGCAAAGAGGACTACAATGCCGCCTTTCCGCTC
TTTGTCCTTGCCGCAAAGCACGGGCATGCCGAGTCTGCATATCGTGCGGCTCTTTGCTACGAGTTTGGCTGGGGC
TGCCGCAAGGACCCGGCAAAGGCGGTGCAGTTCTTGCGCCTGGCAGCCTCGAAGCGTCATCCCGGGGCCATGACG
CGCCTGGGCAAAGCGTGTCTGTCGGGCGACTTGGGCGAAAAGAGATATCGTGAGGGCATCAAGTGGCTCAAGCTA
GCGACCGAGGCAGCCGACGCCCAGTACAACAATGCTCCCTACCAGCTGGGGTGCCTGTATGAGACGGGATACGGG
GACGATGTTTTTGAGGACCTGAGCTACGCGGCCGAGCTCTATACACAGGCGGCCGAGCTGGGCCACCCCGAGGCC
AACTACCGCATGGGCGAGGCCTATGAACACGGCACTCTCAACTGCCCCAAGGATGCGGCGCTGAGTGTGCACTTT
TATACCGGCGCTGCTGAGCGCGGGCACGCAGCCGCCATGATGGGTCTCTGCGCCTGGTACATGGTTGGAGCACCG
CCCATTATGGACAAGGACGAGGAAGAGGCGTATGAATGGGCTCGCCGCTCGGCCCAACTTGGCTACGCCAAGGCT
CAATATGCTGTCGGCTACTTTACCGAGATGGGCATTGGCTGCCGGCGCGACATGCTCGAGGCCAACGTGTGGTAC
GTCAAGGCAGCCGATGCTGGCGACGAGCGAGCCAGACAGCGGCTGGCCGTCATTCAAGCGGCAGCCAGTGGCGGC
GGCATGCCCATGGACGTTGCGCCGCCTCGCAACGCCAAGATGGCCAAGGACGACAAGGACTGCGTGGTAATGTGA
Transcript >OphauB2|3046
ATGTCTTCAACAACCACTGCAAGTAGAAATCACGACTCGCTGCGCTCCATGCCACCTGCTGGTGCTAGATCGTCT
CACAGGGTCCCTCGCAAACCTCTGGTGCAATCAAACGCACCGGCAAACAGGACTCAGCTCCGTGATGGCTCTCTA
TGCCCCGCCGAGTCGAAATACCAAGACGACGGCTGCGCCCCTTTATCCAGAATCAATGTCGAGTCGCGCGTGCGA
GCAGCCAACAAGCTTTCCAAGGCATTGCCCAAGCTGCCCTTGGCTCGCGATGCAGTGTTTGACTCGGGCGATAAA
GGATTCATGGTTGCTTCGCCGTCGCTGGCACTTGATGGCGATGAGATGACGCTGTCACGGGGCAGACGCTGCAGC
ACGGATAATGCGATAGAGTTTGATGACGTGGGCGCCAATTCAAACCTTGGTGCGGCTTCAACGCCTGGCCAGTTG
GATGCAACGGCCGTTAGCCCCTACAAACAAGGGCTCCGGGGTGTCTTTCGCAACAGCCGCGAATCAGACGAGACA
GCCAGCAGCGGGCACCAAGCAGGCTCTGTTCATTCCTCGGCTCCAACAAGCACGAGCTCCGTCTATGGTAGCAAT
GATGCCACCGAGTGCTCGCCCCATCAGCTCTCTCCCCAAGGCTCGGTGCTCGACGGCAGACAAGGGCAAATAGAA
AGCATTCCGCAGTTCCATTATCACCACCAACGAGACTACTCGCCGCGCCCTAGCAATGGCAACCCGGACGCGGCC
CGGCCATCTCTCACTCCAGATCAGCTCGATAGCACTGCACACGGGGGCCGCCACCTGACGCCCTTGTCGGGCTAC
TTTGGCAGAGCCTCTCAGTCGCGGCCGCAGTCGTCGTACTCTTTGTGGTCGGAAAATGCCCCTCGGGGCCCGTCT
CCCAATCTTTCGCCCCGAGGCTCGCACTTGCGCGCCCCCTCGTTGCAGTCGCGCAAGTCTCCAGATGCCAGACCC
TCGTCGTACGCCGAGCTGCTCAATGTGCCCTATCCACAACAAGCCCCGGCGCCTCTCACTCTGGACAACTCCAAC
TTGCGCAGCGCCGTGGGCAACAACGCATCGCTCCTCAGCACGCAAAAGACGCTTGACATGTACCGCCAAAACGTC
AAAAAGACAAACGACTTCTCCATCCAGTACTCGTTTGCCGTATTCCTCATCTCCACAGCACAGGAGCTGGGACTC
GACATGGCCGACGCCATGGCGCGCAAGCCCAGCCCACACCCCCCTCGCGACTTGGACAGCTCGTGCTTCACTGCC
AATCCCTTTGAGATGGTGCGAGAGGCTCGCCAGATCCTGCAGCGCCTTGCCAACGGCGGATACCCCTTTGCTCAG
TACTACCTGGCCGACGGCTTTGCCTCGGGGCTCTTTAGCAAAGGCAAAGAGGACTACAATGCCGCCTTTCCGCTC
TTTGTCCTTGCCGCAAAGCACGGGCATGCCGAGTCTGCATATCGTGCGGCTCTTTGCTACGAGTTTGGCTGGGGC
TGCCGCAAGGACCCGGCAAAGGCGGTGCAGTTCTTGCGCCTGGCAGCCTCGAAGCGTCATCCCGGGGCCATGACG
CGCCTGGGCAAAGCGTGTCTGTCGGGCGACTTGGGCGAAAAGAGATATCGTGAGGGCATCAAGTGGCTCAAGCTA
GCGACCGAGGCAGCCGACGCCCAGTACAACAATGCTCCCTACCAGCTGGGGTGCCTGTATGAGACGGGATACGGG
GACGATGTTTTTGAGGACCTGAGCTACGCGGCCGAGCTCTATACACAGGCGGCCGAGCTGGGCCACCCCGAGGCC
AACTACCGCATGGGCGAGGCCTATGAACACGGCACTCTCAACTGCCCCAAGGATGCGGCGCTGAGTGTGCACTTT
TATACCGGCGCTGCTGAGCGCGGGCACGCAGCCGCCATGATGGGTCTCTGCGCCTGGTACATGGTTGGAGCACCG
CCCATTATGGACAAGGACGAGGAAGAGGCGTATGAATGGGCTCGCCGCTCGGCCCAACTTGGCTACGCCAAGGCT
CAATATGCTGTCGGCTACTTTACCGAGATGGGCATTGGCTGCCGGCGCGACATGCTCGAGGCCAACGTGTGGTAC
GTCAAGGCAGCCGATGCTGGCGACGAGCGAGCCAGACAGCGGCTGGCCGTCATTCAAGCGGCAGCCAGTGGCGGC
GGCATGCCCATGGACGTTGCGCCGCCTCGCAACGCCAAGATGGCCAAGGACGACAAGGACTGCGTGGTAATGTGA
Gene >OphauB2|3046
ATGTCTTCAACAACCACTGCAAGTAGAAATCACGACTCGCTGCGCTCCATGCCACCTGCTGGTGCTAGATCGTCT
CACAGGGTCCCTCGCAAACCTCTGGTGCAATCAAACGCACCGGCAAACAGGACTCAGCTCCGTGATGGCTCTCTA
TGCCCCGCCGAGTCGAAATACCAAGACGACGGCTGCGCCCCTTTATCCAGAATCAATGTCGAGTCGCGCGTGCGA
GCAGCCAACAAGCTTTCCAAGGCATTGCCCAAGCTGCCCTTGGCTCGCGATGCAGTGTTTGACTCGGGCGATAAA
GGATTCATGGTTGCTTCGCCGTCGCTGGCACTTGATGGCGATGAGATGACGCTGTCACGGGGCAGACGCTGCAGC
ACGGATAATGCGATAGAGTTTGATGACGTGGGCGCCAATTCAAACCTTGGTGCGGCTTCAACGCCTGGCCAGTTG
GATGCAACGGCCGTTAGCCCCTACAAACAAGGGCTCCGGGGTGTCTTTCGCAACAGCCGCGAATCAGACGAGACA
GCCAGCAGCGGGCACCAAGCAGGCTCTGTTCATTCCTCGGCTCCAACAAGCACGAGCTCCGTCTATGGTAGCAAT
GATGCCACCGAGTGCTCGCCCCATCAGCTCTCTCCCCAAGGCTCGGTGCTCGACGGCAGACAAGGGCAAATAGAA
AGCATTCCGCAGTTCCATTATCACCACCAACGAGACTACTCGCCGCGCCCTAGCAATGGCAACCCGGACGCGGCC
CGGCCATCTCTCACTCCAGATCAGCTCGATAGCACTGCACACGGGGGCCGCCACCTGACGCCCTTGTCGGGCTAC
TTTGGCAGAGCCTCTCAGTCGCGGCCGCAGTCGTCGTACTCTTTGTGGTCGGAAAATGCCCCTCGGGGCCCGTCT
CCCAATCTTTCGCCCCGAGGCTCGCACTTGCGCGCCCCCTCGTTGCAGTCGCGCAAGTCTCCAGATGCCAGACCC
TCGTCGTACGCCGAGCTGCTCAATGTGCCCTATCCACAACAAGCCCCGGCGCCTCTCACTCTGGACAACTCCAAC
TTGCGCAGCGCCGTGGGCAACAACGCATCGCTCCTCAGCACGCAAAAGACGCTTGACATGTACCGCCAAAACGTC
AAAAAGACAAACGACTTCTCCATCCAGTACTCGTTTGCCGTATTCCTCATCTCCACAGCACAGGAGCTGGGACTC
GACATGGCCGACGCCATGGCGCGCAAGCCCAGCCCACACCCCCCTCGCGACTTGGACAGCTCGTGCTTCACTGCC
AATCCCTTTGAGATGGTGCGAGAGGCTCGCCAGATCCTGCAGCGCCTTGCCAACGGCGGATACCCCTTTGCTCAG
TACTACCTGGCCGACGGCTTTGCCTCGGGGCTCTTTAGCAAAGGCAAAGAGGACTACAATGCCGCCTTTCCGCTC
TTTGTCCTTGCCGCAAAGCACGGGCATGCCGAGTCTGCATATCGTGCGGCTCTTTGCTACGAGTTTGGCTGGGGC
TGCCGCAAGGACCCGGCAAAGGCGGTGCAGTTCTTGCGCCTGGCAGCCTCGAAGCGTCATCCCGGGGCCATGACG
CGCCTGGGCAAAGCGTGTCTGTCGGGCGACTTGGGCGAAAAGAGATATCGTGAGGGCATCAAGTGGCTCAAGCTA
GCGACCGAGGCAGCCGACGCCCAGTACAACAATGCTCCCTACCAGCTGGGGTGCCTGTATGAGACGGGATACGGG
GACGATGTTTTTGAGGACCTGAGCTACGCGGCCGAGCTCTATACACAGGCGGCCGAGCTGGGCCACCCCGAGGCC
AACTACCGCATGGGCGAGGCCTATGAACACGGCACTCTCAACTGCCCCAAGGATGCGGCGCTGAGTGTGCACTTT
TATACCGGCGCTGCTGAGCGCGGGCACGCAGCCGCCATGATGGGTCTCTGCGCCTGGTACATGGTTGGAGCACCG
CCCATTATGGACAAGGACGAGGAAGAGGCGTATGAATGGGCTCGCCGCTCGGCCCAACTTGGTATGTGGCAAAGG
GCAGCTTGCGTCGAGTCATGGGAGTGCTGACACGGTGCCTTTGCTGGCGGCGGGCATGGCAGGCTACGCCAAGGC
TCAATATGCTGTCGGCTACTTTACCGAGATGGGCATTGGCTGCCGGCGCGACATGCTCGAGGCCAACGTGTGGTA
CGTCAAGGCAGCCGATGCTGGCGACGAGCGAGCCAGACAGCGGCTGGCCGTCATTCAAGCGGCAGCCAGTGGCGG
CGGCATGCCCATGGACGTTGCGCCGCCTCGCAACGCCAAGATGGCCAAGGACGACAAGGACTGCGTGGTAATGTG
A

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail