Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|303
Gene name
LocationContig_101:25339..26063
Strand-
Gene length (bp)724
Transcript length (bp)483
Coding sequence length (bp)483
Protein length (aa) 161

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05907 CXXC_Zn-b_euk CXXC motif containing zinc binding protein, eukaryotic 1.1E-64 3 158

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74797|YGN3_SCHPO UPF0587 protein C2D10.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC2D10.03c PE=3 SV=1 2 160 2.0E-46
sp|Q9BI88|U587_CAEEL UPF0587 protein F46B6.12 OS=Caenorhabditis elegans GN=F46B6.12 PE=3 SV=2 2 153 6.0E-30
sp|Q9NWV4|CA123_HUMAN UPF0587 protein C1orf123 OS=Homo sapiens GN=C1orf123 PE=1 SV=1 2 154 2.0E-29
sp|Q3B8G0|CA123_XENLA UPF0587 protein C1orf123 homolog OS=Xenopus laevis PE=2 SV=1 2 153 2.0E-28
sp|Q32P66|CA123_BOVIN UPF0587 protein C1orf123 homolog OS=Bos taurus PE=2 SV=1 4 153 3.0E-28
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74797|YGN3_SCHPO UPF0587 protein C2D10.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC2D10.03c PE=3 SV=1 2 160 2.0E-46
sp|Q9BI88|U587_CAEEL UPF0587 protein F46B6.12 OS=Caenorhabditis elegans GN=F46B6.12 PE=3 SV=2 2 153 6.0E-30
sp|Q9NWV4|CA123_HUMAN UPF0587 protein C1orf123 OS=Homo sapiens GN=C1orf123 PE=1 SV=1 2 154 2.0E-29
sp|Q3B8G0|CA123_XENLA UPF0587 protein C1orf123 homolog OS=Xenopus laevis PE=2 SV=1 2 153 2.0E-28
sp|Q32P66|CA123_BOVIN UPF0587 protein C1orf123 homolog OS=Bos taurus PE=2 SV=1 4 153 3.0E-28
sp|Q8BHG2|CA123_MOUSE UPF0587 protein C1orf123 homolog OS=Mus musculus PE=1 SV=1 2 153 1.0E-27
sp|Q498R7|CA123_RAT UPF0587 protein C1orf123 homolog OS=Rattus norvegicus PE=2 SV=1 2 153 2.0E-27
sp|A7SJ66|U587_NEMVE UPF0587 protein v1g245604 OS=Nematostella vectensis GN=v1g245604 PE=3 SV=1 4 150 1.0E-25
sp|P25654|YCY0_YEAST UPF0587 protein YCR090C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCR090C PE=1 SV=1 2 159 2.0E-20
sp|Q290L7|U587_DROPS UPF0587 protein GA18326 OS=Drosophila pseudoobscura pseudoobscura GN=GA18326 PE=3 SV=1 4 154 2.0E-17
sp|A1Z9A2|U587_DROME UPF0587 protein CG4646 OS=Drosophila melanogaster GN=CG4646 PE=2 SV=1 4 153 5.0E-16
sp|Q55C72|U587_DICDI UPF0587 protein OS=Dictyostelium discoideum GN=DDB_G0270194 PE=3 SV=1 4 132 5.0E-11
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|303
MFVLQVKAELSGVTNLRPDDSQDNPFWYMFRVQCTSCRETHGNYVGVNRFELNEMSGSRGEANFVWKCKNCKRES
TASIKAAAVPYAQSDPPQTQRLVEFDCRGCEFTEFKPEGEWLAEGTDSGTKFSNIELVDGEWFDYDEKAGDEVSI
KEIVWEIRRA*
Coding >OphauB2|303
ATGTTTGTTCTTCAAGTCAAGGCAGAGCTTTCAGGGGTGACCAATCTGCGCCCAGACGACTCCCAGGACAATCCG
TTCTGGTACATGTTCAGGGTGCAGTGCACCTCTTGCAGGGAGACACACGGCAACTATGTGGGAGTAAATCGCTTT
GAACTGAATGAGATGAGCGGTAGTCGCGGCGAGGCCAACTTTGTATGGAAATGCAAAAATTGCAAGCGAGAGTCG
ACTGCGTCCATCAAAGCCGCTGCTGTTCCCTATGCGCAAAGTGACCCTCCTCAGACCCAACGACTCGTTGAGTTT
GATTGTCGAGGCTGTGAATTTACAGAGTTCAAGCCAGAGGGCGAGTGGCTGGCTGAAGGCACCGACTCTGGCACC
AAATTTAGCAATATAGAGCTCGTCGACGGCGAGTGGTTTGACTATGACGAAAAGGCGGGGGACGAGGTCAGCATC
AAGGAAATTGTATGGGAGATTCGGCGAGCTTGA
Transcript >OphauB2|303
ATGTTTGTTCTTCAAGTCAAGGCAGAGCTTTCAGGGGTGACCAATCTGCGCCCAGACGACTCCCAGGACAATCCG
TTCTGGTACATGTTCAGGGTGCAGTGCACCTCTTGCAGGGAGACACACGGCAACTATGTGGGAGTAAATCGCTTT
GAACTGAATGAGATGAGCGGTAGTCGCGGCGAGGCCAACTTTGTATGGAAATGCAAAAATTGCAAGCGAGAGTCG
ACTGCGTCCATCAAAGCCGCTGCTGTTCCCTATGCGCAAAGTGACCCTCCTCAGACCCAACGACTCGTTGAGTTT
GATTGTCGAGGCTGTGAATTTACAGAGTTCAAGCCAGAGGGCGAGTGGCTGGCTGAAGGCACCGACTCTGGCACC
AAATTTAGCAATATAGAGCTCGTCGACGGCGAGTGGTTTGACTATGACGAAAAGGCGGGGGACGAGGTCAGCATC
AAGGAAATTGTATGGGAGATTCGGCGAGCTTGA
Gene >OphauB2|303
ATGTTTGTTCTTCAAGTCAAGGCAGAGCTTTCAGGGTAGGACTCTCTGCGACGTATCCTAGCTGCAGCTCTCACT
CACCAAAATCGCTCAGGGTGACCAATCTGCGCCCAGACGACTCCCAGGACAATCCGTTCTGGTACATGTTCAGGG
TGCAGTGCACCTCTTGCAGGGAGACACACGGCAACTATGTGGGAGTAAATCGCTTTGTATGGATGCGCCGCGTCG
AGCCTAGTTCATGGTGGACGCGCCACTGATTGCCCAGACGATAGGAACTGAATGAGATGAGCGGTAGTCGCGGCG
AGGCCAACTTTGTATGGAAATGCAAAAATTGCAAGGCATGGGATGACTGATGGTTATCTCCAAGCATGGCTCGGC
TAATGGAATGCTGTCAGCGAGAGTCGACTGCGTCCATCAAAGCCGCTGCTGTTCCCTATGCGCAAAGTGACCCTC
CTCAGACCCAACGACTCGTTGAGTTTGATTGTCGAGGCTGTGAATTTACAGAGTTCAAGCCAGAGGTAGGCTTTT
TGCCTTGATGCATGCAAGTTGCTTTCCTCAAACTCACAAATGCCTGCTTGGACAGGGCGAGTGGCTGGCTGAAGG
CACCGACTCTGGCACCAAATTTAGCAATATAGAGCTCGTCGACGGCGAGTGGTTTGACTATGACGAAAAGGCGGG
GGACGAGGTCAGCATCAAGGAAATTGTATGGGAGATTCGGCGAGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail