Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3024
Gene name
LocationContig_2:322071..324346
Strand+
Gene length (bp)2275
Transcript length (bp)2142
Coding sequence length (bp)2142
Protein length (aa) 714

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20497 SWI-SNF_Ssr4_C SWI/SNF and RSC complexes subunit Ssr4 C-terminal 6.5E-100 265 551
PF20497 SWI-SNF_Ssr4_C SWI/SNF and RSC complexes subunit Ssr4 C-terminal 1.0E-30 547 702
PF08549 SWI-SNF_Ssr4_N SWI/SNF and RSC complexes subunit Ssr4 N-terminal 5.0E-98 5 213

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9P7Y0|SSR4_SCHPO SWI/SNF and RSC complexes subunit ssr4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ssr4 PE=1 SV=1 9 312 5.0E-14

GO

GO Term Description Terminal node
GO:0006338 chromatin remodeling Yes
GO:0071840 cellular component organization or biogenesis No
GO:0009987 cellular process No
GO:0008150 biological_process No
GO:0016043 cellular component organization No
GO:0006325 chromatin organization No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4073
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6803
Ophiocordyceps australis map64 (Brazil) OphauB2|3024 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|07335
Ophiocordyceps camponoti-rufipedis Ophun1|5598
Ophiocordyceps kimflemingae Ophio5|8378
Ophiocordyceps subramaniannii Hirsu2|8213

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3024
MAQMDPSHSVPQELMSHVHLVSAFRYPTVARLDVNEVVRWLMNAPQVARDRAPFFWTYLDKPTDGTVLLTWQPLQ
RLNSNFATDGFIWAPPEQVYKQELGNGLILEIYYLKAGYMPGEQFALHARRRFRLMPMPGHPNPPQIDMSLFIVH
YGPSDHNDRIPAAMVPYDERVNAIMQQRHYLLRGGQIRRKEFMLSDRVNWPILPELTRQQMAPQMGPQMMGRGVP
QQMAYPPQPVAPPPAKRARHSAGQGAPSVIGPGMQPPEGLEDEEDITRGDMFDQATQRDVSMGRFKQSYEWMEEI
LSSAYRMNQIMPSDLNLGLKGELSALTEGIFTAQGVEVFTQAPDKPYVGKLDEGLADEFRKRVDEYIKTTEAEID
EIKAQHAKTMASLKTGSVFTVKEAELRALSAEPAAAEPAKGDETSEAGGGEPEPDGQARHRPMFKKAVDDVSRDV
EAAIGRKIVRHPNVRRIQQGGYQAPEPQLAAHMSRQASHNSGVMMGDADVDMGGTAAGLLDQMHSGLSSTSTPVN
TAPTPQPAATPSHAMSAPSPVPNASDEQPKTSDDWVVVPRNDAPPAHAPPPPAPVVPPGPTTPQAPPPDTGPEPE
ARPGHDAAPNAPPQPASEPPAAPPKPTSAAATPAATDGGSAAFDQNDFSSLGDLDTAGDALAGYDAPDLDGAPGD
LGQGLDLQMDIDDSAFGDAFHGVNASDTPGPDQQNQDV*
Coding >OphauB2|3024
ATGGCGCAAATGGACCCTAGCCATAGCGTTCCACAGGAACTTATGTCGCACGTTCACCTGGTGTCGGCATTTCGA
TATCCCACAGTGGCACGGCTCGACGTCAACGAGGTTGTCAGGTGGCTCATGAACGCTCCACAGGTCGCCAGAGAT
CGAGCGCCCTTTTTTTGGACCTATCTCGACAAGCCGACGGATGGCACCGTGCTGCTGACGTGGCAGCCGCTGCAA
AGGCTCAACTCCAACTTTGCAACGGATGGCTTCATCTGGGCGCCACCAGAACAAGTTTACAAGCAGGAGCTGGGC
AACGGGCTGATTCTCGAGATTTACTACCTAAAGGCCGGATACATGCCCGGGGAGCAATTTGCGTTGCACGCGCGA
CGACGCTTCCGGCTGATGCCCATGCCGGGCCACCCCAATCCGCCTCAGATTGACATGAGTCTGTTTATTGTGCAC
TACGGCCCATCGGATCACAATGACCGCATTCCTGCCGCCATGGTGCCCTACGACGAGCGAGTCAATGCCATCATG
CAGCAGCGCCATTACCTTTTGCGAGGCGGCCAGATCCGGCGCAAGGAATTCATGCTCTCGGACCGCGTCAACTGG
CCCATTTTGCCCGAGCTCACGCGGCAGCAGATGGCGCCCCAGATGGGACCGCAGATGATGGGCAGAGGCGTACCT
CAGCAGATGGCATATCCGCCTCAGCCTGTTGCACCGCCGCCGGCCAAGCGAGCTAGGCATAGCGCAGGACAGGGC
GCGCCGTCCGTGATTGGCCCGGGCATGCAGCCGCCCGAGGGGCTGGAAGACGAGGAAGATATTACCAGGGGCGAC
ATGTTTGACCAAGCAACGCAGCGAGACGTGTCGATGGGCCGATTCAAGCAGAGCTACGAGTGGATGGAGGAGATC
TTGTCGTCGGCCTACAGGATGAACCAGATTATGCCGTCGGATCTCAACCTGGGGCTCAAGGGCGAGCTGTCAGCG
CTGACCGAGGGCATCTTTACCGCGCAGGGCGTCGAAGTCTTTACTCAAGCTCCTGACAAGCCATATGTGGGCAAG
CTTGACGAGGGCTTGGCCGATGAGTTCCGTAAGCGAGTCGACGAGTACATCAAGACGACCGAGGCGGAAATAGAC
GAAATCAAGGCTCAACACGCCAAGACCATGGCCTCACTCAAGACAGGCTCCGTCTTCACCGTCAAGGAGGCTGAG
CTTCGGGCCCTGTCGGCCGAGCCGGCTGCGGCTGAGCCTGCCAAGGGCGACGAGACGAGCGAGGCGGGCGGCGGC
GAGCCCGAGCCCGACGGCCAGGCGCGACACCGGCCCATGTTCAAAAAGGCGGTTGACGACGTGTCGCGCGACGTC
GAGGCGGCCATTGGACGCAAGATAGTGCGCCACCCCAATGTTAGGCGCATTCAGCAGGGCGGCTATCAGGCTCCA
GAGCCGCAGCTGGCGGCGCACATGTCTCGGCAGGCGTCGCACAATAGCGGCGTCATGATGGGCGACGCAGACGTG
GACATGGGCGGCACGGCGGCCGGCCTGCTGGACCAGATGCACTCGGGGCTGTCGTCCACGTCGACGCCCGTCAAC
ACTGCGCCCACGCCCCAGCCCGCCGCCACGCCCTCGCACGCCATGAGTGCGCCTTCGCCCGTGCCGAATGCGTCT
GACGAACAGCCCAAGACGTCGGACGATTGGGTTGTGGTGCCTCGCAACGACGCCCCGCCCGCCCATGCCCCGCCG
CCCCCGGCCCCCGTCGTCCCGCCCGGCCCCACCACTCCGCAGGCCCCACCTCCGGATACCGGACCCGAGCCCGAG
GCCCGCCCCGGCCACGACGCAGCGCCCAATGCCCCCCCCCAGCCTGCCTCTGAGCCCCCCGCTGCGCCTCCCAAA
CCCACGTCGGCCGCCGCCACGCCTGCCGCCACGGACGGCGGCTCAGCAGCCTTTGACCAAAACGACTTTAGCTCG
CTCGGAGATCTCGATACTGCCGGCGATGCCCTGGCCGGCTACGACGCGCCAGACCTCGACGGCGCCCCCGGCGAT
CTGGGCCAGGGGCTCGATCTGCAAATGGATATTGACGACTCGGCCTTTGGTGACGCCTTTCACGGCGTCAATGCC
TCGGACACGCCCGGCCCCGACCAGCAGAACCAGGATGTCTAG
Transcript >OphauB2|3024
ATGGCGCAAATGGACCCTAGCCATAGCGTTCCACAGGAACTTATGTCGCACGTTCACCTGGTGTCGGCATTTCGA
TATCCCACAGTGGCACGGCTCGACGTCAACGAGGTTGTCAGGTGGCTCATGAACGCTCCACAGGTCGCCAGAGAT
CGAGCGCCCTTTTTTTGGACCTATCTCGACAAGCCGACGGATGGCACCGTGCTGCTGACGTGGCAGCCGCTGCAA
AGGCTCAACTCCAACTTTGCAACGGATGGCTTCATCTGGGCGCCACCAGAACAAGTTTACAAGCAGGAGCTGGGC
AACGGGCTGATTCTCGAGATTTACTACCTAAAGGCCGGATACATGCCCGGGGAGCAATTTGCGTTGCACGCGCGA
CGACGCTTCCGGCTGATGCCCATGCCGGGCCACCCCAATCCGCCTCAGATTGACATGAGTCTGTTTATTGTGCAC
TACGGCCCATCGGATCACAATGACCGCATTCCTGCCGCCATGGTGCCCTACGACGAGCGAGTCAATGCCATCATG
CAGCAGCGCCATTACCTTTTGCGAGGCGGCCAGATCCGGCGCAAGGAATTCATGCTCTCGGACCGCGTCAACTGG
CCCATTTTGCCCGAGCTCACGCGGCAGCAGATGGCGCCCCAGATGGGACCGCAGATGATGGGCAGAGGCGTACCT
CAGCAGATGGCATATCCGCCTCAGCCTGTTGCACCGCCGCCGGCCAAGCGAGCTAGGCATAGCGCAGGACAGGGC
GCGCCGTCCGTGATTGGCCCGGGCATGCAGCCGCCCGAGGGGCTGGAAGACGAGGAAGATATTACCAGGGGCGAC
ATGTTTGACCAAGCAACGCAGCGAGACGTGTCGATGGGCCGATTCAAGCAGAGCTACGAGTGGATGGAGGAGATC
TTGTCGTCGGCCTACAGGATGAACCAGATTATGCCGTCGGATCTCAACCTGGGGCTCAAGGGCGAGCTGTCAGCG
CTGACCGAGGGCATCTTTACCGCGCAGGGCGTCGAAGTCTTTACTCAAGCTCCTGACAAGCCATATGTGGGCAAG
CTTGACGAGGGCTTGGCCGATGAGTTCCGTAAGCGAGTCGACGAGTACATCAAGACGACCGAGGCGGAAATAGAC
GAAATCAAGGCTCAACACGCCAAGACCATGGCCTCACTCAAGACAGGCTCCGTCTTCACCGTCAAGGAGGCTGAG
CTTCGGGCCCTGTCGGCCGAGCCGGCTGCGGCTGAGCCTGCCAAGGGCGACGAGACGAGCGAGGCGGGCGGCGGC
GAGCCCGAGCCCGACGGCCAGGCGCGACACCGGCCCATGTTCAAAAAGGCGGTTGACGACGTGTCGCGCGACGTC
GAGGCGGCCATTGGACGCAAGATAGTGCGCCACCCCAATGTTAGGCGCATTCAGCAGGGCGGCTATCAGGCTCCA
GAGCCGCAGCTGGCGGCGCACATGTCTCGGCAGGCGTCGCACAATAGCGGCGTCATGATGGGCGACGCAGACGTG
GACATGGGCGGCACGGCGGCCGGCCTGCTGGACCAGATGCACTCGGGGCTGTCGTCCACGTCGACGCCCGTCAAC
ACTGCGCCCACGCCCCAGCCCGCCGCCACGCCCTCGCACGCCATGAGTGCGCCTTCGCCCGTGCCGAATGCGTCT
GACGAACAGCCCAAGACGTCGGACGATTGGGTTGTGGTGCCTCGCAACGACGCCCCGCCCGCCCATGCCCCGCCG
CCCCCGGCCCCCGTCGTCCCGCCCGGCCCCACCACTCCGCAGGCCCCACCTCCGGATACCGGACCCGAGCCCGAG
GCCCGCCCCGGCCACGACGCAGCGCCCAATGCCCCCCCCCAGCCTGCCTCTGAGCCCCCCGCTGCGCCTCCCAAA
CCCACGTCGGCCGCCGCCACGCCTGCCGCCACGGACGGCGGCTCAGCAGCCTTTGACCAAAACGACTTTAGCTCG
CTCGGAGATCTCGATACTGCCGGCGATGCCCTGGCCGGCTACGACGCGCCAGACCTCGACGGCGCCCCCGGCGAT
CTGGGCCAGGGGCTCGATCTGCAAATGGATATTGACGACTCGGCCTTTGGTGACGCCTTTCACGGCGTCAATGCC
TCGGACACGCCCGGCCCCGACCAGCAGAACCAGGATGTCTAG
Gene >OphauB2|3024
ATGGCGCAAATGGACCCTAGCCATAGCGTTCCACAGGAACTTGTACGTGTCTAGCTATTGAGACGATTCTAAGCA
TGAGGCAGCCATGTGGAATGGCTAACGACGGCGCTATGCAGATGTCGCACGTTCACCTGGTGTCGGCATTTCGAT
ATCCCACAGTGGCACGGCTCGACGTCAACGAGGTTGTCAGGTGGCTCATGAACGCTCCACAGGTCGCCAGAGATC
GAGCGCCCTTTTTTTGGACCTATCTCGACAAGCCGACGGATGGCACCGTGCTGCTGACGTGGCAGCCGCTGCAAA
GGCTCAACTCCAACTTTGCAACGGATGGCTTCATCTGGGCGCCACCAGAACAAGTTTACAAGCAGGAGCTGGGCA
ACGGGCTGGTGCGTGCTTGGTCCTGACTGCGTCGAGTCTCAAGACTCTGTACTGACGCAGCACCTAGATTCTCGA
GATTTACTACCTAAAGGCCGGATACATGCCCGGGGAGCAATTTGCGTTGCACGCGCGACGACGCTTCCGGCTGAT
GCCCATGCCGGGCCACCCCAATCCGCCTCAGATTGACATGAGTCTGTTTATTGTGCACTACGGCCCATCGGATCA
CAATGACCGCATTCCTGCCGCCATGGTGCCCTACGACGAGCGAGTCAATGCCATCATGCAGCAGCGCCATTACCT
TTTGCGAGGCGGCCAGATCCGGCGCAAGGAATTCATGCTCTCGGACCGCGTCAACTGGCCCATTTTGCCCGAGCT
CACGCGGCAGCAGATGGCGCCCCAGATGGGACCGCAGATGATGGGCAGAGGCGTACCTCAGCAGATGGCATATCC
GCCTCAGCCTGTTGCACCGCCGCCGGCCAAGCGAGCTAGGCATAGCGCAGGACAGGGCGCGCCGTCCGTGATTGG
CCCGGGCATGCAGCCGCCCGAGGGGCTGGAAGACGAGGAAGATATTACCAGGGGCGACATGTTTGACCAAGCAAC
GCAGCGAGACGTGTCGATGGGCCGATTCAAGCAGAGCTACGAGTGGATGGAGGAGATCTTGTCGTCGGCCTACAG
GATGAACCAGATTATGCCGTCGGATCTCAACCTGGGGCTCAAGGGCGAGCTGTCAGCGCTGACCGAGGGCATCTT
TACCGCGCAGGGCGTCGAAGTCTTTACTCAAGCTCCTGACAAGCCATATGTGGGCAAGCTTGACGAGGGCTTGGC
CGATGAGTTCCGTAAGCGAGTCGACGAGTACATCAAGACGACCGAGGCGGAAATAGACGAAATCAAGGCTCAACA
CGCCAAGACCATGGCCTCACTCAAGACAGGCTCCGTCTTCACCGTCAAGGAGGCTGAGCTTCGGGCCCTGTCGGC
CGAGCCGGCTGCGGCTGAGCCTGCCAAGGGCGACGAGACGAGCGAGGCGGGCGGCGGCGAGCCCGAGCCCGACGG
CCAGGCGCGACACCGGCCCATGTTCAAAAAGGCGGTTGACGACGTGTCGCGCGACGTCGAGGCGGCCATTGGACG
CAAGATAGTGCGCCACCCCAATGTTAGGCGCATTCAGCAGGGCGGCTATCAGGCTCCAGAGCCGCAGCTGGCGGC
GCACATGTCTCGGCAGGCGTCGCACAATAGCGGCGTCATGATGGGCGACGCAGACGTGGACATGGGCGGCACGGC
GGCCGGCCTGCTGGACCAGATGCACTCGGGGCTGTCGTCCACGTCGACGCCCGTCAACACTGCGCCCACGCCCCA
GCCCGCCGCCACGCCCTCGCACGCCATGAGTGCGCCTTCGCCCGTGCCGAATGCGTCTGACGAACAGCCCAAGAC
GTCGGACGATTGGGTTGTGGTGCCTCGCAACGACGCCCCGCCCGCCCATGCCCCGCCGCCCCCGGCCCCCGTCGT
CCCGCCCGGCCCCACCACTCCGCAGGCCCCACCTCCGGATACCGGACCCGAGCCCGAGGCCCGCCCCGGCCACGA
CGCAGCGCCCAATGCCCCCCCCCAGCCTGCCTCTGAGCCCCCCGCTGCGCCTCCCAAACCCACGTCGGCCGCCGC
CACGCCTGCCGCCACGGACGGCGGCTCAGCAGCCTTTGACCAAAACGACTTTAGCTCGCTCGGAGATCTCGATAC
TGCCGGCGATGCCCTGGCCGGCTACGACGCGCCAGACCTCGACGGCGCCCCCGGCGATCTGGGCCAGGGGCTCGA
TCTGCAAATGGATATTGACGACTCGGCCTTTGGTGACGCCTTTCACGGCGTCAATGCCTCGGACACGCCCGGCCC
CGACCAGCAGAACCAGGATGTCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail