Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3023
Gene name
LocationContig_2:319233..321238
Strand+
Gene length (bp)2005
Transcript length (bp)1482
Coding sequence length (bp)1482
Protein length (aa) 494

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00393 6PGD 6-phosphogluconate dehydrogenase, C-terminal domain 6.5E-131 181 479
PF03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase 2.1E-49 8 176

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38720|6PGD1_YEAST 6-phosphogluconate dehydrogenase, decarboxylating 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GND1 PE=1 SV=1 6 493 0.0E+00
sp|P53319|6PGD2_YEAST 6-phosphogluconate dehydrogenase, decarboxylating 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GND2 PE=1 SV=1 1 493 0.0E+00
sp|O83351|6PGD_TREPA 6-phosphogluconate dehydrogenase, decarboxylating OS=Treponema pallidum (strain Nichols) GN=gnd PE=3 SV=1 6 492 0.0E+00
sp|P43774|6PGD_HAEIN 6-phosphogluconate dehydrogenase, decarboxylating OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=gnd PE=3 SV=1 7 491 0.0E+00
sp|Q8TA03|6PGD_DICDI 6-phosphogluconate dehydrogenase, decarboxylating OS=Dictyostelium discoideum GN=gnd PE=1 SV=1 1 491 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38720|6PGD1_YEAST 6-phosphogluconate dehydrogenase, decarboxylating 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GND1 PE=1 SV=1 6 493 0.0E+00
sp|P53319|6PGD2_YEAST 6-phosphogluconate dehydrogenase, decarboxylating 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GND2 PE=1 SV=1 1 493 0.0E+00
sp|O83351|6PGD_TREPA 6-phosphogluconate dehydrogenase, decarboxylating OS=Treponema pallidum (strain Nichols) GN=gnd PE=3 SV=1 6 492 0.0E+00
sp|P43774|6PGD_HAEIN 6-phosphogluconate dehydrogenase, decarboxylating OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=gnd PE=3 SV=1 7 491 0.0E+00
sp|Q8TA03|6PGD_DICDI 6-phosphogluconate dehydrogenase, decarboxylating OS=Dictyostelium discoideum GN=gnd PE=1 SV=1 1 491 0.0E+00
sp|Q7VMX4|6PGD_HAEDU 6-phosphogluconate dehydrogenase, decarboxylating OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=gnd PE=3 SV=1 7 491 0.0E+00
sp|P70718|6PGD_AGGAC 6-phosphogluconate dehydrogenase, decarboxylating OS=Aggregatibacter actinomycetemcomitans GN=gnd PE=3 SV=1 7 491 0.0E+00
sp|P41573|6PGD_DROSI 6-phosphogluconate dehydrogenase, decarboxylating OS=Drosophila simulans GN=Pgd PE=3 SV=1 1 493 0.0E+00
sp|P41572|6PGD_DROME 6-phosphogluconate dehydrogenase, decarboxylating OS=Drosophila melanogaster GN=Pgd PE=2 SV=1 1 493 0.0E+00
sp|P41570|6PGD_CERCA 6-phosphogluconate dehydrogenase, decarboxylating OS=Ceratitis capitata GN=Pgd PE=2 SV=1 6 493 0.0E+00
sp|Q9DCD0|6PGD_MOUSE 6-phosphogluconate dehydrogenase, decarboxylating OS=Mus musculus GN=Pgd PE=1 SV=3 6 493 0.0E+00
sp|Q17761|6PGD_CAEEL 6-phosphogluconate dehydrogenase, decarboxylating OS=Caenorhabditis elegans GN=T25B9.9 PE=3 SV=2 6 493 0.0E+00
sp|P00349|6PGD_SHEEP 6-phosphogluconate dehydrogenase, decarboxylating OS=Ovis aries GN=PGD PE=1 SV=4 6 493 0.0E+00
sp|P52209|6PGD_HUMAN 6-phosphogluconate dehydrogenase, decarboxylating OS=Homo sapiens GN=PGD PE=1 SV=3 6 493 0.0E+00
sp|O60037|6PGD_CUNEL 6-phosphogluconate dehydrogenase, decarboxylating OS=Cunninghamella elegans GN=6-PGD PE=2 SV=1 1 493 0.0E+00
sp|P78812|6PGD_SCHPO 6-phosphogluconate dehydrogenase, decarboxylating OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC660.16 PE=1 SV=2 5 493 0.0E+00
sp|O13287|6PGD_CANAX 6-phosphogluconate dehydrogenase, decarboxylating OS=Candida albicans GN=DOR14 PE=3 SV=1 7 493 0.0E+00
sp|P85968|6PGD_RAT 6-phosphogluconate dehydrogenase, decarboxylating OS=Rattus norvegicus GN=Pgd PE=1 SV=1 6 493 0.0E+00
sp|Q9CHU6|6PGD_LACLA 6-phosphogluconate dehydrogenase, decarboxylating OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=gnd PE=3 SV=1 6 459 5.0E-180
sp|P80859|6PGD_BACSU 6-phosphogluconate dehydrogenase, NADP(+)-dependent, decarboxylating OS=Bacillus subtilis (strain 168) GN=gndA PE=1 SV=4 8 459 3.0E-179
sp|P96789|6PGD_LACLM 6-phosphogluconate dehydrogenase, decarboxylating OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=gnd PE=1 SV=3 6 459 1.0E-178
sp|Q931R3|6PGD_STAAM 6-phosphogluconate dehydrogenase, decarboxylating OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=gnd PE=3 SV=1 8 461 3.0E-177
sp|P63335|6PGD_STAAW 6-phosphogluconate dehydrogenase, decarboxylating OS=Staphylococcus aureus (strain MW2) GN=gnd PE=3 SV=1 8 461 6.0E-176
sp|Q5HFR2|6PGD_STAAC 6-phosphogluconate dehydrogenase, decarboxylating OS=Staphylococcus aureus (strain COL) GN=gnd PE=3 SV=1 8 461 6.0E-176
sp|P63334|6PGD_STAAN 6-phosphogluconate dehydrogenase, decarboxylating OS=Staphylococcus aureus (strain N315) GN=gnd PE=1 SV=1 8 461 6.0E-176
sp|Q6GGI7|6PGD_STAAR 6-phosphogluconate dehydrogenase, decarboxylating OS=Staphylococcus aureus (strain MRSA252) GN=gnd PE=3 SV=1 8 461 6.0E-176
sp|Q6G954|6PGD_STAAS 6-phosphogluconate dehydrogenase, decarboxylating OS=Staphylococcus aureus (strain MSSA476) GN=gnd PE=3 SV=1 8 461 6.0E-176
sp|Q9Z8I3|6PGD_CHLPN 6-phosphogluconate dehydrogenase, decarboxylating OS=Chlamydia pneumoniae GN=gnd PE=3 SV=1 6 480 4.0E-171
sp|P00350|6PGD_ECOLI 6-phosphogluconate dehydrogenase, decarboxylating OS=Escherichia coli (strain K12) GN=gnd PE=1 SV=2 8 459 1.0E-165
sp|P37756|6PGD_SHIFL 6-phosphogluconate dehydrogenase, decarboxylating OS=Shigella flexneri GN=gnd PE=3 SV=1 8 459 5.0E-165
sp|O84066|6PGD_CHLTR 6-phosphogluconate dehydrogenase, decarboxylating OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=gnd PE=3 SV=1 4 479 1.0E-164
sp|P14062|6PGD_SALTY 6-phosphogluconate dehydrogenase, decarboxylating OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=gnd PE=3 SV=1 8 459 3.0E-164
sp|P41582|6PGD_CITKO 6-phosphogluconate dehydrogenase, decarboxylating (Fragment) OS=Citrobacter koseri GN=gnd PE=3 SV=1 14 459 9.0E-164
sp|P41575|6PGD_RAOPL 6-phosphogluconate dehydrogenase, decarboxylating (Fragment) OS=Raoultella planticola GN=gnd PE=3 SV=1 14 459 1.0E-163
sp|P41580|6PGD_SHISO 6-phosphogluconate dehydrogenase, decarboxylating (Fragment) OS=Shigella sonnei GN=gnd PE=3 SV=1 14 459 1.0E-163
sp|P41576|6PGD_KLEPN 6-phosphogluconate dehydrogenase, decarboxylating OS=Klebsiella pneumoniae GN=gnd PE=3 SV=2 8 459 1.0E-163
sp|P41574|6PGD_ESCVU 6-phosphogluconate dehydrogenase, decarboxylating (Fragment) OS=Escherichia vulneris GN=gnd PE=3 SV=1 14 459 2.0E-163
sp|P41579|6PGD_SHIDY 6-phosphogluconate dehydrogenase, decarboxylating (Fragment) OS=Shigella dysenteriae GN=gnd PE=3 SV=1 14 459 3.0E-163
sp|Q9PKX7|6PGD_CHLMU 6-phosphogluconate dehydrogenase, decarboxylating OS=Chlamydia muridarum (strain MoPn / Nigg) GN=gnd PE=3 SV=1 6 481 6.0E-163
sp|P21577|6PGD_SYNE7 6-phosphogluconate dehydrogenase, decarboxylating OS=Synechococcus elongatus (strain PCC 7942) GN=gnd PE=1 SV=4 8 458 1.0E-162
sp|P41578|6PGD_SHIBO 6-phosphogluconate dehydrogenase, decarboxylating (Fragment) OS=Shigella boydii GN=gnd PE=3 SV=1 14 459 1.0E-162
sp|P41583|6PGD_CITFR 6-phosphogluconate dehydrogenase, decarboxylating (Fragment) OS=Citrobacter freundii GN=gnd PE=3 SV=1 14 459 1.0E-162
sp|P37754|6PGD9_ECOLX 6-phosphogluconate dehydrogenase, decarboxylating OS=Escherichia coli GN=gnd PE=3 SV=1 8 459 1.0E-162
sp|P41577|6PGD_RAOTE 6-phosphogluconate dehydrogenase, decarboxylating (Fragment) OS=Raoultella terrigena GN=gnd PE=3 SV=1 14 459 2.0E-162
sp|P41581|6PGD_CITAM 6-phosphogluconate dehydrogenase, decarboxylating (Fragment) OS=Citrobacter amalonaticus GN=gnd PE=3 SV=1 14 459 4.0E-162
sp|P52208|6PGD_SYNY3 6-phosphogluconate dehydrogenase, decarboxylating OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=gnd PE=3 SV=1 8 479 2.0E-160
sp|Q8CP47|6PGD_STAES 6-phosphogluconate dehydrogenase, decarboxylating OS=Staphylococcus epidermidis (strain ATCC 12228) GN=gnd PE=3 SV=1 8 461 7.0E-154
sp|Q5HP42|6PGD_STAEQ 6-phosphogluconate dehydrogenase, decarboxylating OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=gnd PE=3 SV=1 8 461 7.0E-154
sp|Q2R480|6PGD2_ORYSJ 6-phosphogluconate dehydrogenase, decarboxylating 2, chloroplastic OS=Oryza sativa subsp. japonica GN=G6PGH2 PE=2 SV=1 8 480 4.0E-153
sp|P57208|6PGD_BUCAI 6-phosphogluconate dehydrogenase, decarboxylating OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=gnd PE=3 SV=1 8 459 9.0E-153
sp|Q94KU1|6PGD1_SPIOL 6-phosphogluconate dehydrogenase, decarboxylating 1 OS=Spinacia oleracea GN=pgdC PE=1 SV=1 4 458 1.0E-150
sp|Q9FFR3|6PGD2_ARATH 6-phosphogluconate dehydrogenase, decarboxylating 2, chloroplastic OS=Arabidopsis thaliana GN=At5g41670 PE=1 SV=1 5 458 9.0E-150
sp|Q9LI00|6PGD1_ORYSJ 6-phosphogluconate dehydrogenase, decarboxylating 1 OS=Oryza sativa subsp. japonica GN=G6PGH1 PE=2 SV=1 5 458 7.0E-149
sp|Q94KU2|6PGD2_SPIOL 6-phosphogluconate dehydrogenase, decarboxylating 2, chloroplastic OS=Spinacia oleracea GN=pgdP PE=1 SV=1 6 458 2.0E-148
sp|Q9FWA3|6GPD3_ARATH 6-phosphogluconate dehydrogenase, decarboxylating 3 OS=Arabidopsis thaliana GN=At3g02360 PE=2 SV=1 8 458 3.0E-147
sp|Q9ZHD9|6PGD_BUCAP 6-phosphogluconate dehydrogenase, decarboxylating OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=gnd PE=3 SV=2 8 482 5.0E-147
sp|P12013|6PGDH_BACSU 6-phosphogluconate dehydrogenase, NAD(+)-dependent, decarboxylating OS=Bacillus subtilis (strain 168) GN=gntZ PE=1 SV=1 8 480 3.0E-146
sp|Q9SH69|6PGD1_ARATH 6-phosphogluconate dehydrogenase, decarboxylating 1, chloroplastic OS=Arabidopsis thaliana GN=At1g64190 PE=1 SV=1 2 458 6.0E-146
sp|Q89AX5|6PGD_BUCBP 6-phosphogluconate dehydrogenase, decarboxylating OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=gnd PE=3 SV=1 8 479 8.0E-143
sp|P52207|6PGD_BACLI 6-phosphogluconate dehydrogenase, decarboxylating OS=Bacillus licheniformis GN=gntZ PE=3 SV=1 8 458 1.0E-140
sp|P14332|6PGD_PIG 6-phosphogluconate dehydrogenase, decarboxylating (Fragment) OS=Sus scrofa GN=PGD PE=2 SV=3 234 493 1.0E-91
sp|P31072|6PGD_TRYBB 6-phosphogluconate dehydrogenase, decarboxylating OS=Trypanosoma brucei brucei GN=GND PE=1 SV=1 19 458 3.0E-91
sp|C8VP36|6PGD_EMENI 6-phosphogluconate dehydrogenase, decarboxylating OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN10233 PE=3 SV=1 16 476 2.0E-62
sp|P54448|YQEC_BACSU Putative 6-phosphogluconate dehydrogenase YqeC OS=Bacillus subtilis (strain 168) GN=yqeC PE=3 SV=1 8 296 8.0E-39
sp|G5EBD7|6PGDH_GLUOX 6-phosphogluconate dehydrogenase, NAD(+)-dependent, decarboxylating OS=Gluconobacter oxydans (strain 621H) GN=GOX1705 PE=1 SV=1 8 307 3.0E-34
sp|D4GST8|6PGD_HALVD 6-phosphogluconate dehydrogenase, NAD(+)-dependent, decarboxylating OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=gndA PE=1 SV=1 8 307 3.0E-32
sp|Q9SZE1|3HID1_ARATH Probable 3-hydroxyisobutyrate dehydrogenase-like 1, mitochondrial OS=Arabidopsis thaliana GN=At4g29120 PE=1 SV=1 8 188 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006098 pentose-phosphate shunt Yes
GO:0050661 NADP binding Yes
GO:0004616 phosphogluconate dehydrogenase (decarboxylating) activity Yes
GO:0097159 organic cyclic compound binding No
GO:0016614 oxidoreductase activity, acting on CH-OH group of donors No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0006091 generation of precursor metabolites and energy No
GO:0003674 molecular_function No
GO:0006793 phosphorus metabolic process No
GO:0000166 nucleotide binding No
GO:0006796 phosphate-containing compound metabolic process No
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor No
GO:0019637 organophosphate metabolic process No
GO:0003824 catalytic activity No
GO:1901135 carbohydrate derivative metabolic process No
GO:0006740 NADPH regeneration No
GO:1901265 nucleoside phosphate binding No
GO:1901363 heterocyclic compound binding No
GO:0071704 organic substance metabolic process No
GO:0044237 cellular metabolic process No
GO:0036094 small molecule binding No
GO:0006739 NADP metabolic process No
GO:0008152 metabolic process No
GO:0051156 glucose 6-phosphate metabolic process No
GO:0009987 cellular process No
GO:0016491 oxidoreductase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3023
MSGPVADLGLIGLAVMGQNLILNMADHGFTICAFNRTVSKVDHFLENEAKGKSIVGAHSIEEFVGKLKKPRRVML
LVQAGQAVDDWIAKLLPLLQDGDIIIDGGNSHFPDSNRRSKELRAKKIRFVGSGVSGGEEGARYGPSLMPGGNEE
AWPHIKDIFQGIAAKSDGEACCEWVGDDGAGHYVKMVHNGIEYGDMQLICEAYDIMKRGLGLSNKEMGDVFAQWN
KGVLDSFLIEITRDLMYYNDDDGKPLVEKILDKAGQKGTGKWTAVNALDLGMPVTLIAEAVLARCLSSIKDERVE
ASQKLQYVSRKSGKFEGDKKQFLEDLEQALYASKIISYAQGFMLMQEAAKEYGWKLNKPSIALMWRGGCIIRSVF
LKDITAAYRKEPNLKNLLFDDFFNKAIHKAQPGWRDVVAQAAELGIPTPAFSTALTWFDGYRTKDLPANLLQAQR
DYFGAHTFRIKPEFASDTYPKDKDIHVNWTGRGGNVSASTYQA*
Coding >OphauB2|3023
ATGTCTGGCCCTGTTGCTGATCTAGGCCTCATCGGCCTTGCCGTCATGGGACAGAACCTCATTCTCAACATGGCC
GACCATGGCTTTACCATTTGTGCATTCAACCGAACCGTCTCCAAGGTCGACCACTTTTTGGAAAACGAGGCCAAG
GGCAAGTCCATTGTGGGCGCCCACTCAATCGAGGAGTTTGTTGGCAAACTCAAGAAGCCTCGCCGCGTCATGCTG
CTCGTCCAGGCCGGCCAAGCCGTAGACGATTGGATTGCCAAGCTTCTGCCTCTGCTCCAAGATGGCGACATCATC
ATTGATGGCGGCAACTCTCACTTTCCTGACTCGAACCGCCGCTCCAAAGAACTCCGCGCCAAGAAGATCAGATTT
GTTGGCTCCGGCGTCTCCGGCGGCGAGGAGGGTGCTCGCTATGGTCCATCACTCATGCCTGGCGGCAACGAAGAG
GCCTGGCCGCACATCAAGGACATTTTCCAAGGCATTGCCGCCAAGAGCGATGGCGAGGCCTGCTGCGAGTGGGTC
GGTGACGATGGTGCTGGTCACTACGTCAAGATGGTCCACAATGGCATCGAGTATGGCGACATGCAGCTCATTTGC
GAGGCATATGACATTATGAAGCGTGGTCTTGGCCTCTCCAACAAGGAGATGGGCGACGTCTTTGCCCAATGGAAC
AAGGGAGTCCTCGACTCTTTCCTTATTGAAATCACCCGTGACCTCATGTACTACAATGATGACGATGGCAAGCCA
CTTGTGGAGAAGATTCTCGACAAGGCTGGCCAGAAGGGCACGGGCAAGTGGACTGCCGTCAATGCCCTCGACCTC
GGCATGCCCGTAACCCTCATTGCCGAGGCCGTCCTTGCTCGCTGCTTGTCCAGCATCAAGGATGAGCGCGTCGAG
GCATCTCAAAAGCTGCAATACGTCAGCCGCAAGAGCGGCAAATTCGAGGGCGACAAGAAGCAGTTCTTGGAGGAT
CTGGAACAGGCCCTCTATGCGTCCAAGATTATTTCATACGCTCAAGGCTTCATGTTAATGCAAGAGGCGGCCAAG
GAGTATGGCTGGAAGCTCAACAAGCCCTCAATCGCCCTCATGTGGCGCGGTGGGTGTATTATCCGCTCCGTCTTC
CTCAAGGACATTACGGCGGCATATCGCAAGGAGCCCAACTTGAAGAACCTGCTCTTTGACGACTTCTTTAACAAG
GCCATCCACAAGGCTCAGCCTGGATGGAGAGACGTGGTTGCACAGGCGGCAGAGCTGGGCATTCCGACGCCTGCC
TTTTCGACAGCTCTGACGTGGTTTGACGGGTACCGGACCAAGGACTTGCCGGCCAACCTGCTGCAGGCTCAGCGA
GACTACTTTGGCGCCCATACATTCCGCATTAAGCCCGAGTTTGCCAGCGACACGTATCCCAAGGACAAGGATATT
CATGTCAACTGGACTGGCCGTGGTGGCAACGTATCTGCCTCGACATATCAGGCGTAA
Transcript >OphauB2|3023
ATGTCTGGCCCTGTTGCTGATCTAGGCCTCATCGGCCTTGCCGTCATGGGACAGAACCTCATTCTCAACATGGCC
GACCATGGCTTTACCATTTGTGCATTCAACCGAACCGTCTCCAAGGTCGACCACTTTTTGGAAAACGAGGCCAAG
GGCAAGTCCATTGTGGGCGCCCACTCAATCGAGGAGTTTGTTGGCAAACTCAAGAAGCCTCGCCGCGTCATGCTG
CTCGTCCAGGCCGGCCAAGCCGTAGACGATTGGATTGCCAAGCTTCTGCCTCTGCTCCAAGATGGCGACATCATC
ATTGATGGCGGCAACTCTCACTTTCCTGACTCGAACCGCCGCTCCAAAGAACTCCGCGCCAAGAAGATCAGATTT
GTTGGCTCCGGCGTCTCCGGCGGCGAGGAGGGTGCTCGCTATGGTCCATCACTCATGCCTGGCGGCAACGAAGAG
GCCTGGCCGCACATCAAGGACATTTTCCAAGGCATTGCCGCCAAGAGCGATGGCGAGGCCTGCTGCGAGTGGGTC
GGTGACGATGGTGCTGGTCACTACGTCAAGATGGTCCACAATGGCATCGAGTATGGCGACATGCAGCTCATTTGC
GAGGCATATGACATTATGAAGCGTGGTCTTGGCCTCTCCAACAAGGAGATGGGCGACGTCTTTGCCCAATGGAAC
AAGGGAGTCCTCGACTCTTTCCTTATTGAAATCACCCGTGACCTCATGTACTACAATGATGACGATGGCAAGCCA
CTTGTGGAGAAGATTCTCGACAAGGCTGGCCAGAAGGGCACGGGCAAGTGGACTGCCGTCAATGCCCTCGACCTC
GGCATGCCCGTAACCCTCATTGCCGAGGCCGTCCTTGCTCGCTGCTTGTCCAGCATCAAGGATGAGCGCGTCGAG
GCATCTCAAAAGCTGCAATACGTCAGCCGCAAGAGCGGCAAATTCGAGGGCGACAAGAAGCAGTTCTTGGAGGAT
CTGGAACAGGCCCTCTATGCGTCCAAGATTATTTCATACGCTCAAGGCTTCATGTTAATGCAAGAGGCGGCCAAG
GAGTATGGCTGGAAGCTCAACAAGCCCTCAATCGCCCTCATGTGGCGCGGTGGGTGTATTATCCGCTCCGTCTTC
CTCAAGGACATTACGGCGGCATATCGCAAGGAGCCCAACTTGAAGAACCTGCTCTTTGACGACTTCTTTAACAAG
GCCATCCACAAGGCTCAGCCTGGATGGAGAGACGTGGTTGCACAGGCGGCAGAGCTGGGCATTCCGACGCCTGCC
TTTTCGACAGCTCTGACGTGGTTTGACGGGTACCGGACCAAGGACTTGCCGGCCAACCTGCTGCAGGCTCAGCGA
GACTACTTTGGCGCCCATACATTCCGCATTAAGCCCGAGTTTGCCAGCGACACGTATCCCAAGGACAAGGATATT
CATGTCAACTGGACTGGCCGTGGTGGCAACGTATCTGCCTCGACATATCAGGCGTAA
Gene >OphauB2|3023
ATGTCTGGCCCTGTGTGAGTTCCTGGCGCTGATGCTCCTCGCAAGTTTTGCTCCGTCTTGCTCCGTCTTGCTCCG
TTGGCCTTACCCCACCACCCCGCCCAAAGTCATGATGACCTCAATTCGCGCATTTGCCTGCCAGCCTTGAGCCTT
TGCTTGCCACGGCCTTTGCACGTCTTGTGCTTGTCAGACTTGACTCGGTCCGATCTCATGCTCATACATGACATA
GCGCCCGTCTCGCTAACCTCAAGCTTGGCGGCGCCGAGCCCTCCACTTCTTCATCTGCTCCCCTCTGTGTGCCTG
CTCCGAACCGCGCTGCAAGCGCTGCTGACAATGCTCCCAGTGCTGATCTAGGCCTCATCGGCCTTGCCGTCATGT
AAGTTGGACAGTCTGCCATGGCTCCACGCCCTGTGAGCTTGCTGACGAGCCGCCCAACAGGGGACAGAACCTCAT
TCTCAACATGGCCGACCATGGCTTTACCATTTGTGCATTCAACCGAACCGTCTCCAAGGTCGACCACTTTTTGGA
AAACGAGGCCAAGGGCAAGTCCATTGTGGGCGCCCACTCAATCGAGGAGTTTGTTGGCAAACTCAAGAAGCCTCG
CCGCGTCATGCTGCTCGTCCAGGCCGGCCAAGCCGTAGACGATTGGATTGCCAAGCTTCTGCCTCTGCTCCAAGA
TGGCGACATCATCATTGATGGCGGCAACTCTCACTTTCCTGACTCGAACCGCCGCTCCAAAGAACTCCGCGCCAA
GAAGATCAGATTTGTTGGCTCCGGCGTCTCCGGCGGCGAGGAGGGTGCTCGCTATGGTCCATCACTCATGCCTGG
CGGCAACGAAGAGGCCTGGCCGCACATCAAGGACATTTTCCAAGGCATTGCCGCCAAGAGCGATGGCGAGGCCTG
CTGCGAGTGGGTCGGTGACGATGGTGCTGGTCACTACGTCAAGATGGTCCACAATGGCATCGAGTATGGCGACAT
GCAGCTCATTTGCGAGGTGCGTCATGATAGCCAACATCACCAGTAGAAGCACTTTGGCTCAACTGACACGCGAAC
TCTATAGGCATATGACATTATGAAGCGTGGTCTTGGCCTCTCCAACAAGGAGATGGGCGACGTCTTTGCCCAATG
GAACAAGGGAGTCCTCGACTCTTTCCTTATTGAAATCACCCGTGACCTCATGTACTACAATGATGACGATGGCAA
GCCACTTGTGGAGAAGATTCTCGACAAGGCTGGCCAGAAGGGCACGGGCAAGTGGACTGCCGTCAATGCCCTCGA
CCTCGGCATGCCCGTAACCCTCATTGCCGAGGCCGTCCTTGCTCGCTGCTTGTCCAGCATCAAGGATGAGCGCGT
CGAGGCATCTCAAAAGCTGCAATACGTCAGCCGCAAGAGCGGCAAATTCGAGGGCGACAAGAAGCAGTTCTTGGA
GGATCTGGAACAGGCCCTCTATGCGTCCAAGATTATTTCATACGCTCAAGGCTTCATGTTAATGCAAGAGGCAAG
TCATGCTCGTTTGATGCCCAAGCGATTTGGTTCTTGCTGACAAGAGTGGAAAATGACATAAAAGGCGGCCAAGGA
GTATGGCTGGAAGCTCAACAAGCCCTCAATCGCCCTCATGTGGCGCGGTGGGTGTATTATCCGCTCCGTCTTCCT
CAAGGACATTACGGCGGCATATCGCAAGGAGCCCAACTTGAAGAACCTGCTCTTTGACGACTTCTTTAACAAGGC
CATCCACAAGGCTCAGCCTGGATGGAGAGACGTGGTTGCACAGGCGGCAGAGCTGGGCATTCCGACGCCTGCCTT
TTCGACAGCTCTGACGTGGTTTGACGGGTACCGGACCAAGGACTTGCCGGCCAACCTGCTGCAGGCTCAGCGAGA
CTACTTTGGCGCCCATACATTCCGCATTAAGCCCGAGTTTGCCAGCGACACGTATCCCAAGGACAAGGATATTCA
TGTCAACTGGACTGGCCGTGGTGGCAACGTATCTGCCTCGACATATCAGGCGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail