Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|302
Gene name
LocationContig_101:24532..25075
Strand-
Gene length (bp)543
Transcript length (bp)543
Coding sequence length (bp)543
Protein length (aa) 181

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04032 Rpr2 RNAse P Rpr2/Rpp21/SNM1 subunit domain 8.4E-14 9 111

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O94306|YCGJ_SCHPO Uncharacterized protein C16C4.19 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC16C4.19 PE=4 SV=1 9 177 2.0E-07

GO

GO Term Description Terminal node
GO:0006396 RNA processing Yes
GO:0044238 primary metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0009987 cellular process No
GO:0006807 nitrogen compound metabolic process No
GO:0016070 RNA metabolic process No
GO:0008150 biological_process No
GO:0008152 metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0044237 cellular metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|302
MDSSQLAAKLSFLTDAAHLLRNSVPVASAHLMRQRAERMQQANLDQHELQQQHVCRACGHIMIPGRGSELSLKPP
RHASSPRRKRRRHPKPRTKAAEAPRGPTKALTCGLCFDKCHTQLAPPSAPAVRRSSVGANTTKPPNASTSKKRAR
MRKSGLEALLAGQEQKSKAASLSLADFRQK*
Coding >OphauB2|302
ATGGATTCAAGCCAACTAGCCGCCAAGCTGAGCTTCCTCACCGATGCAGCGCACTTGCTGCGCAACTCGGTGCCG
GTGGCATCGGCCCACCTCATGAGACAGCGCGCCGAGAGAATGCAGCAGGCCAATCTGGACCAGCACGAGCTGCAG
CAGCAACACGTCTGCCGCGCCTGTGGCCACATCATGATTCCGGGGCGTGGCTCTGAGCTGAGCCTCAAGCCGCCA
AGACACGCCTCGTCACCCAGGAGAAAGCGCAGACGGCATCCCAAGCCACGAACCAAGGCTGCCGAGGCCCCTCGA
GGCCCTACCAAGGCTCTGACTTGTGGCCTCTGCTTTGACAAGTGCCACACGCAGCTCGCACCTCCCAGCGCCCCG
GCAGTGCGTCGCAGTAGCGTCGGCGCAAATACAACAAAGCCGCCCAATGCCAGCACGAGCAAAAAGAGAGCTAGG
ATGCGTAAATCTGGTCTTGAGGCTTTGCTGGCAGGCCAAGAGCAGAAATCCAAGGCGGCCTCGTTGTCGCTGGCC
GACTTTAGACAGAAATAA
Transcript >OphauB2|302
ATGGATTCAAGCCAACTAGCCGCCAAGCTGAGCTTCCTCACCGATGCAGCGCACTTGCTGCGCAACTCGGTGCCG
GTGGCATCGGCCCACCTCATGAGACAGCGCGCCGAGAGAATGCAGCAGGCCAATCTGGACCAGCACGAGCTGCAG
CAGCAACACGTCTGCCGCGCCTGTGGCCACATCATGATTCCGGGGCGTGGCTCTGAGCTGAGCCTCAAGCCGCCA
AGACACGCCTCGTCACCCAGGAGAAAGCGCAGACGGCATCCCAAGCCACGAACCAAGGCTGCCGAGGCCCCTCGA
GGCCCTACCAAGGCTCTGACTTGTGGCCTCTGCTTTGACAAGTGCCACACGCAGCTCGCACCTCCCAGCGCCCCG
GCAGTGCGTCGCAGTAGCGTCGGCGCAAATACAACAAAGCCGCCCAATGCCAGCACGAGCAAAAAGAGAGCTAGG
ATGCGTAAATCTGGTCTTGAGGCTTTGCTGGCAGGCCAAGAGCAGAAATCCAAGGCGGCCTCGTTGTCGCTGGCC
GACTTTAGACAGAAATAA
Gene >OphauB2|302
ATGGATTCAAGCCAACTAGCCGCCAAGCTGAGCTTCCTCACCGATGCAGCGCACTTGCTGCGCAACTCGGTGCCG
GTGGCATCGGCCCACCTCATGAGACAGCGCGCCGAGAGAATGCAGCAGGCCAATCTGGACCAGCACGAGCTGCAG
CAGCAACACGTCTGCCGCGCCTGTGGCCACATCATGATTCCGGGGCGTGGCTCTGAGCTGAGCCTCAAGCCGCCA
AGACACGCCTCGTCACCCAGGAGAAAGCGCAGACGGCATCCCAAGCCACGAACCAAGGCTGCCGAGGCCCCTCGA
GGCCCTACCAAGGCTCTGACTTGTGGCCTCTGCTTTGACAAGTGCCACACGCAGCTCGCACCTCCCAGCGCCCCG
GCAGTGCGTCGCAGTAGCGTCGGCGCAAATACAACAAAGCCGCCCAATGCCAGCACGAGCAAAAAGAGAGCTAGG
ATGCGTAAATCTGGTCTTGAGGCTTTGCTGGCAGGCCAAGAGCAGAAATCCAAGGCGGCCTCGTTGTCGCTGGCC
GACTTTAGACAGAAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail