Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3017
Gene name
LocationContig_2:307802..308158
Strand-
Gene length (bp)356
Transcript length (bp)288
Coding sequence length (bp)288
Protein length (aa) 96

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|201
Ophiocordyceps australis 1348a (Ghana) OphauG2|7422
Ophiocordyceps australis 1348a (Ghana) OphauG2|7411
Ophiocordyceps australis 1348a (Ghana) OphauG2|6241
Ophiocordyceps australis 1348a (Ghana) OphauG2|4898
Ophiocordyceps australis 1348a (Ghana) OphauG2|4897
Ophiocordyceps australis 1348a (Ghana) OphauG2|2708
Ophiocordyceps australis 1348a (Ghana) OphauG2|2128
Ophiocordyceps australis 1348a (Ghana) OphauG2|1191
Ophiocordyceps australis 1348a (Ghana) OphauG2|1124
Ophiocordyceps australis 1348a (Ghana) OphauG2|7710
Ophiocordyceps australis map64 (Brazil) OphauB2|4459
Ophiocordyceps australis map64 (Brazil) OphauB2|5387
Ophiocordyceps australis map64 (Brazil) OphauB2|476
Ophiocordyceps australis map64 (Brazil) OphauB2|5635
Ophiocordyceps australis map64 (Brazil) OphauB2|3063
Ophiocordyceps australis map64 (Brazil) OphauB2|5406
Ophiocordyceps australis map64 (Brazil) OphauB2|3017 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|712
Ophiocordyceps australis map64 (Brazil) OphauB2|1455
Ophiocordyceps australis map64 (Brazil) OphauB2|1454
Ophiocordyceps australis map64 (Brazil) OphauB2|6068
Ophiocordyceps australis map64 (Brazil) OphauB2|6715
Ophiocordyceps australis map64 (Brazil) OphauB2|5636
Ophiocordyceps australis map64 (Brazil) OphauB2|7340
Ophiocordyceps australis map64 (Brazil) OphauB2|7710
Ophiocordyceps australis map64 (Brazil) OphauB2|2028
Ophiocordyceps australis map64 (Brazil) OphauB2|5805
Ophiocordyceps camponoti-floridani Ophcf2|02942
Ophiocordyceps subramaniannii Hirsu2|8482
Ophiocordyceps subramaniannii Hirsu2|8480
Ophiocordyceps subramaniannii Hirsu2|7800
Ophiocordyceps subramaniannii Hirsu2|7724
Ophiocordyceps subramaniannii Hirsu2|6729
Ophiocordyceps subramaniannii Hirsu2|5683
Ophiocordyceps subramaniannii Hirsu2|5301
Ophiocordyceps subramaniannii Hirsu2|5151
Ophiocordyceps subramaniannii Hirsu2|4977
Ophiocordyceps subramaniannii Hirsu2|4297
Ophiocordyceps subramaniannii Hirsu2|4296
Ophiocordyceps subramaniannii Hirsu2|3325
Ophiocordyceps subramaniannii Hirsu2|26
Ophiocordyceps subramaniannii Hirsu2|25
Ophiocordyceps subramaniannii Hirsu2|9187
Ophiocordyceps subramaniannii Hirsu2|11188

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3017
MPQSRSVALPRHRPFESMSHTDYDTVIFPKVAGAWILNKVALETDYAAASVLLDSFAYYRPGLGLKANSVNLAAI
EDVDYMSEYVELIAALDASV*
Coding >OphauB2|3017
ATGCCACAAAGCCGGTCGGTGGCATTACCCCGCCACAGGCCATTCGAAAGCATGTCACACACCGACTACGATACA
GTCATCTTCCCAAAGGTCGCCGGAGCCTGGATCCTGAATAAAGTGGCCTTGGAGACAGACTACGCGGCTGCCAGC
GTGTTGCTTGATAGTTTCGCCTACTACCGACCAGGACTCGGCCTCAAGGCAAACTCGGTCAACCTCGCCGCCATC
GAGGATGTCGACTACATGTCGGAGTACGTGGAGCTCATCGCCGCCCTCGACGCGTCAGTCTAA
Transcript >OphauB2|3017
ATGCCACAAAGCCGGTCGGTGGCATTACCCCGCCACAGGCCATTCGAAAGCATGTCACACACCGACTACGATACA
GTCATCTTCCCAAAGGTCGCCGGAGCCTGGATCCTGAATAAAGTGGCCTTGGAGACAGACTACGCGGCTGCCAGC
GTGTTGCTTGATAGTTTCGCCTACTACCGACCAGGACTCGGCCTCAAGGCAAACTCGGTCAACCTCGCCGCCATC
GAGGATGTCGACTACATGTCGGAGTACGTGGAGCTCATCGCCGCCCTCGACGCGTCAGTCTAA
Gene >OphauB2|3017
ATGCCACAAAGCCGGTCGGTGGCATTACCCCGCCACAGGCCATTCGAAAGCATGTCACACACCGACTACGATACA
GTCATCTTCCCAAAGGTCGCCGGAGCCTGGATCCTGAATAAAGTGGCCTTGGAGGTGAGGCTGGAGTCGAACTTG
CTCACGATGTTCTCGTCCATTTCGGGCTTTATCGGCCAAACTTCCAGACAGACTACGCGGCTGCCAGCGTGTTGC
TTGATAGTTTCGCCTACTACCGACCAGGACTCGGCCTCAAGGCAAACTCGGTCAACCTCGCCGCCATCGAGGATG
TCGACTACATGTCGGAGTACGTGGAGCTCATCGCCGCCCTCGACGCGTCAGTCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail