Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3014
Gene name
LocationContig_2:302105..303139
Strand+
Gene length (bp)1034
Transcript length (bp)897
Coding sequence length (bp)897
Protein length (aa) 299

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01145 Band_7 SPFH domain / Band 7 family 2.8E-23 50 227

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P50085|PHB2_YEAST Prohibitin-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHB2 PE=1 SV=2 44 290 3.0E-130
sp|O94550|PHB2_SCHPO Prohibitin-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=phb2 PE=1 SV=2 42 290 3.0E-125
sp|Q54Q31|PHB2_DICDI Prohibitin-2 OS=Dictyostelium discoideum GN=phbB PE=3 SV=1 47 296 2.0E-105
sp|Q9ZNT7|PHB2_ARATH Prohibitin-2, mitochondrial OS=Arabidopsis thaliana GN=PHB2 PE=1 SV=1 39 277 2.0E-102
sp|A9UMS3|PHB2_XENTR Prohibitin-2 OS=Xenopus tropicalis GN=phb2 PE=2 SV=1 11 291 1.0E-101
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P50085|PHB2_YEAST Prohibitin-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHB2 PE=1 SV=2 44 290 3.0E-130
sp|O94550|PHB2_SCHPO Prohibitin-2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=phb2 PE=1 SV=2 42 290 3.0E-125
sp|Q54Q31|PHB2_DICDI Prohibitin-2 OS=Dictyostelium discoideum GN=phbB PE=3 SV=1 47 296 2.0E-105
sp|Q9ZNT7|PHB2_ARATH Prohibitin-2, mitochondrial OS=Arabidopsis thaliana GN=PHB2 PE=1 SV=1 39 277 2.0E-102
sp|A9UMS3|PHB2_XENTR Prohibitin-2 OS=Xenopus tropicalis GN=phb2 PE=2 SV=1 11 291 1.0E-101
sp|Q5XIH7|PHB2_RAT Prohibitin-2 OS=Rattus norvegicus GN=Phb2 PE=1 SV=1 11 291 2.0E-101
sp|O35129|PHB2_MOUSE Prohibitin-2 OS=Mus musculus GN=Phb2 PE=1 SV=1 11 291 3.0E-101
sp|Q99623|PHB2_HUMAN Prohibitin-2 OS=Homo sapiens GN=PHB2 PE=1 SV=2 11 291 3.0E-101
sp|Q2HJ97|PHB2_BOVIN Prohibitin-2 OS=Bos taurus GN=PHB2 PE=2 SV=1 11 291 8.0E-101
sp|Q5RB19|PHB2_PONAB Prohibitin-2 OS=Pongo abelii GN=PHB2 PE=2 SV=1 11 291 4.0E-100
sp|O49460|PHB1_ARATH Prohibitin-1, mitochondrial OS=Arabidopsis thaliana GN=PHB1 PE=1 SV=1 45 280 5.0E-99
sp|Q9SIL6|PHB6_ARATH Prohibitin-6, mitochondrial OS=Arabidopsis thaliana GN=PHB6 PE=1 SV=1 23 277 2.0E-98
sp|P50093|PHB2_CAEEL Mitochondrial prohibitin complex protein 2 OS=Caenorhabditis elegans GN=phb-2 PE=1 SV=2 47 291 8.0E-98
sp|Q9FFH5|PHB7_ARATH Prohibitin-7, mitochondrial OS=Arabidopsis thaliana GN=PHB7 PE=1 SV=1 34 287 3.0E-96
sp|Q5ZMN3|PHB2_CHICK Prohibitin-2 OS=Gallus gallus GN=PHB2 PE=2 SV=1 42 291 6.0E-95
sp|P67779|PHB_RAT Prohibitin OS=Rattus norvegicus GN=Phb PE=1 SV=1 30 271 5.0E-91
sp|P67778|PHB_MOUSE Prohibitin OS=Mus musculus GN=Phb PE=1 SV=1 30 271 5.0E-91
sp|P35232|PHB_HUMAN Prohibitin OS=Homo sapiens GN=PHB PE=1 SV=1 30 271 2.0E-90
sp|Q3T165|PHB_BOVIN Prohibitin OS=Bos taurus GN=PHB PE=2 SV=1 30 271 2.0E-90
sp|Q54GI9|PHB1_DICDI Prohibitin-1, mitochondrial OS=Dictyostelium discoideum GN=phbA PE=3 SV=1 29 274 3.0E-90
sp|P84173|PHB_CHICK Prohibitin OS=Gallus gallus GN=PHB PE=1 SV=1 30 271 1.0E-89
sp|P40961|PHB1_YEAST Prohibitin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHB1 PE=1 SV=2 33 285 1.0E-89
sp|Q9P7H3|PHB1_SCHPO Prohibitin-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=phb1 PE=3 SV=1 30 277 3.0E-89
sp|P24156|L2CC_DROME Protein l(2)37Cc OS=Drosophila melanogaster GN=l(2)37Cc PE=2 SV=2 26 271 4.0E-87
sp|O04331|PHB3_ARATH Prohibitin-3, mitochondrial OS=Arabidopsis thaliana GN=PHB3 PE=1 SV=1 21 271 4.0E-87
sp|Q9LK25|PHB4_ARATH Prohibitin-4, mitochondrial OS=Arabidopsis thaliana GN=PHB4 PE=1 SV=1 30 271 3.0E-86
sp|Q9BKU4|PHB1_CAEEL Mitochondrial prohibitin complex protein 1 OS=Caenorhabditis elegans GN=phb-1 PE=1 SV=1 34 279 2.0E-77
sp|Q9LY99|PHB5_ARATH Prohibitin-5, mitochondrial OS=Arabidopsis thaliana GN=PHB5 PE=3 SV=1 47 297 3.0E-58
sp|P86220|PHB_MESAU Prohibitin (Fragments) OS=Mesocricetus auratus GN=PHB PE=1 SV=1 105 217 2.0E-14
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.5

Transmembrane Domains

Domain # Start End Length
1 29 51 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3014
MSGGNNDLNELVQRMRKMPPQWPKGWRNPIAGTGLALAIGAYALSYSLFNVDGGHRGIKYKRTTGVSGDIYNEGT
HFNIPWFETPIVYDVRAKPRNVASLTGTKDLQMVNITCRVLSRPKVDALPQIYRTLGVDYDERVLPSIVNEVLKS
VVAQFNASQLITQREMVARLVRENLSRRAARFNILLDDVSLTHLAFSPEFTAAVEAKQVAQQEAQRAAFVVDKAR
QEKQAMVVKAQGEARSAELIGDAIKKNQAYVELKKIENARLIATQLQEAGAKNKLMLDSEGLGLNVFEVPNKD*
Coding >OphauB2|3014
ATGTCTGGAGGGAATAATGACCTGAACGAGCTGGTGCAGCGCATGAGAAAAATGCCTCCCCAGTGGCCCAAGGGA
TGGAGGAACCCAATTGCTGGCACGGGCCTTGCGCTTGCTATTGGAGCATATGCCCTCTCATACTCGCTTTTCAAC
GTTGACGGTGGCCATCGAGGCATCAAATACAAGCGCACCACCGGCGTGAGCGGCGACATCTACAACGAGGGCACG
CACTTCAATATCCCGTGGTTTGAGACGCCCATAGTCTACGATGTCCGAGCCAAGCCGCGCAACGTGGCATCTCTG
ACGGGCACCAAGGACCTGCAAATGGTCAATATTACATGCCGTGTGCTCTCGCGACCAAAAGTCGATGCCTTGCCA
CAAATTTATCGCACCCTGGGCGTCGACTACGATGAGCGCGTGCTGCCTTCTATTGTCAACGAAGTGCTCAAGAGC
GTCGTGGCTCAGTTCAACGCCAGCCAGCTCATCACGCAGCGAGAAATGGTGGCGCGCCTTGTTCGCGAAAACTTG
TCTCGCAGAGCGGCGCGCTTCAACATTCTTCTCGATGACGTTTCCCTGACGCATCTTGCCTTTTCGCCCGAGTTT
ACTGCGGCCGTCGAAGCCAAGCAGGTGGCCCAGCAAGAGGCCCAACGTGCGGCTTTTGTCGTGGACAAGGCACGA
CAGGAGAAGCAGGCCATGGTGGTCAAGGCACAGGGTGAGGCGCGCTCAGCCGAGCTGATTGGCGATGCCATCAAG
AAGAACCAGGCCTATGTCGAGCTCAAGAAGATTGAGAATGCGCGCCTCATTGCCACGCAGCTGCAAGAGGCCGGC
GCCAAGAATAAGCTGATGCTGGACTCTGAGGGTCTGGGTCTTAACGTCTTTGAGGTCCCTAACAAAGACTAG
Transcript >OphauB2|3014
ATGTCTGGAGGGAATAATGACCTGAACGAGCTGGTGCAGCGCATGAGAAAAATGCCTCCCCAGTGGCCCAAGGGA
TGGAGGAACCCAATTGCTGGCACGGGCCTTGCGCTTGCTATTGGAGCATATGCCCTCTCATACTCGCTTTTCAAC
GTTGACGGTGGCCATCGAGGCATCAAATACAAGCGCACCACCGGCGTGAGCGGCGACATCTACAACGAGGGCACG
CACTTCAATATCCCGTGGTTTGAGACGCCCATAGTCTACGATGTCCGAGCCAAGCCGCGCAACGTGGCATCTCTG
ACGGGCACCAAGGACCTGCAAATGGTCAATATTACATGCCGTGTGCTCTCGCGACCAAAAGTCGATGCCTTGCCA
CAAATTTATCGCACCCTGGGCGTCGACTACGATGAGCGCGTGCTGCCTTCTATTGTCAACGAAGTGCTCAAGAGC
GTCGTGGCTCAGTTCAACGCCAGCCAGCTCATCACGCAGCGAGAAATGGTGGCGCGCCTTGTTCGCGAAAACTTG
TCTCGCAGAGCGGCGCGCTTCAACATTCTTCTCGATGACGTTTCCCTGACGCATCTTGCCTTTTCGCCCGAGTTT
ACTGCGGCCGTCGAAGCCAAGCAGGTGGCCCAGCAAGAGGCCCAACGTGCGGCTTTTGTCGTGGACAAGGCACGA
CAGGAGAAGCAGGCCATGGTGGTCAAGGCACAGGGTGAGGCGCGCTCAGCCGAGCTGATTGGCGATGCCATCAAG
AAGAACCAGGCCTATGTCGAGCTCAAGAAGATTGAGAATGCGCGCCTCATTGCCACGCAGCTGCAAGAGGCCGGC
GCCAAGAATAAGCTGATGCTGGACTCTGAGGGTCTGGGTCTTAACGTCTTTGAGGTCCCTAACAAAGACTAG
Gene >OphauB2|3014
ATGTCTGGAGGGAATAATGACCTGAACGAGCTGGTGCAGCGCATGAGAAAAATGCCTCCCCAGTGGCCCAAGGGA
TGGAGGAACCCAATTGCTGGCACGGGCCTTGCGCTTGCTATTGGAGCATATGCCCTCTCATACTCGCTTTTCAAC
GTTGACGGTGGCCATCGAGGCATCAAATACAAGCGCACCACCGGCGTGAGCGGCGACATCTACAACGAGGGTAAA
GCTATTGACAGGCCTGGGCTTGCTTAGCCGTCAGTTGCTGGCGAGGGAAAGACAGTATCAGCTAATCTGTGGGCA
GGCACGCACTTCAATATCCCGTGGTTTGAGACGCCCATAGTCTACGATGTCCGAGCCAAGCCGCGCAACGTGGCA
TCTCTGACGGGCACCAAGGACCTGCAAATGGTCAATATTACATGCCGTGTGCTCTCGCGACCAAAAGTCGATGCC
TTGCCACAAATTTATCGCACCCTGGGCGTCGACTACGATGAGCGCGTGCTGCCTTCTATTGTCAACGAAGTGCTC
AAGAGCGTCGTGGCTCAGTTCAACGCCAGCCAGCTCATCACGCAGCGAGAAATGGTGGCGCGCCTTGTTCGCGAA
AACTTGTCTCGCAGAGCGGCGCGCTTCAACATTCTTCTCGATGACGTTTCCCTGACGGTGCGGCTTCCTCGCTAG
ATTTCTTGCCCATGTTTACTGACATTGGTGGGCCAAAGCATCTTGCCTTTTCGCCCGAGTTTACTGCGGCCGTCG
AAGCCAAGCAGGTGGCCCAGCAAGAGGCCCAACGTGCGGCTTTTGTCGTGGACAAGGCACGACAGGAGAAGCAGG
CCATGGTGGTCAAGGCACAGGGTGAGGCGCGCTCAGCCGAGCTGATTGGCGATGCCATCAAGAAGAACCAGGCCT
ATGTCGAGCTCAAGAAGATTGAGAATGCGCGCCTCATTGCCACGCAGCTGCAAGAGGCCGGCGCCAAGAATAAGC
TGATGCTGGACTCTGAGGGTCTGGGTCTTAACGTCTTTGAGGTCCCTAACAAAGACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail