Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3008
Gene name
LocationContig_2:284593..285640
Strand-
Gene length (bp)1047
Transcript length (bp)981
Coding sequence length (bp)981
Protein length (aa) 327

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00432 Prenyltrans Prenyltransferase and squalene oxidase repeat 8.5E-10 62 103
PF00432 Prenyltrans Prenyltransferase and squalene oxidase repeat 4.0E-04 118 157
PF00432 Prenyltrans Prenyltransferase and squalene oxidase repeat 2.6E-12 163 205
PF00432 Prenyltrans Prenyltransferase and squalene oxidase repeat 3.5E-10 210 252
PF00432 Prenyltrans Prenyltransferase and squalene oxidase repeat 2.3E-11 258 302

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|B0G172|PGTB2_DICDI Probable geranylgeranyl transferase type-2 subunit beta OS=Dictyostelium discoideum GN=rabggtb PE=3 SV=1 11 323 4.0E-118
sp|P20133|PGTB2_YEAST Geranylgeranyl transferase type-2 subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BET2 PE=1 SV=3 12 325 1.0E-115
sp|Q5E9B3|PGTB2_BOVIN Geranylgeranyl transferase type-2 subunit beta OS=Bos taurus GN=RABGGTB PE=2 SV=1 5 326 1.0E-113
sp|P53611|PGTB2_HUMAN Geranylgeranyl transferase type-2 subunit beta OS=Homo sapiens GN=RABGGTB PE=1 SV=2 5 323 2.0E-113
sp|P53612|PGTB2_MOUSE Geranylgeranyl transferase type-2 subunit beta OS=Mus musculus GN=Rabggtb PE=1 SV=2 2 323 7.0E-112
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|B0G172|PGTB2_DICDI Probable geranylgeranyl transferase type-2 subunit beta OS=Dictyostelium discoideum GN=rabggtb PE=3 SV=1 11 323 4.0E-118
sp|P20133|PGTB2_YEAST Geranylgeranyl transferase type-2 subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BET2 PE=1 SV=3 12 325 1.0E-115
sp|Q5E9B3|PGTB2_BOVIN Geranylgeranyl transferase type-2 subunit beta OS=Bos taurus GN=RABGGTB PE=2 SV=1 5 326 1.0E-113
sp|P53611|PGTB2_HUMAN Geranylgeranyl transferase type-2 subunit beta OS=Homo sapiens GN=RABGGTB PE=1 SV=2 5 323 2.0E-113
sp|P53612|PGTB2_MOUSE Geranylgeranyl transferase type-2 subunit beta OS=Mus musculus GN=Rabggtb PE=1 SV=2 2 323 7.0E-112
sp|Q08603|PGTB2_RAT Geranylgeranyl transferase type-2 subunit beta OS=Rattus norvegicus GN=Rabggtb PE=1 SV=1 2 323 1.0E-111
sp|P46960|PGTB2_SCHPO Geranylgeranyl transferase type-2 subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ptb1 PE=3 SV=1 17 323 4.0E-105
sp|O93830|PGTB2_CANAX Geranylgeranyl transferase type-2 subunit beta OS=Candida albicans GN=BET2 PE=3 SV=1 17 326 2.0E-104
sp|P41992|GGTB2_CAEEL Probable geranylgeranyl transferase type-2 subunit beta OS=Caenorhabditis elegans GN=ggtb-1 PE=3 SV=2 8 320 2.0E-101
sp|O13782|FNTB_SCHPO Protein farnesyltransferase subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cpp1 PE=1 SV=1 8 303 2.0E-34
sp|P53609|PGTB1_HUMAN Geranylgeranyl transferase type-1 subunit beta OS=Homo sapiens GN=PGGT1B PE=1 SV=2 17 324 2.0E-29
sp|Q8BUY9|PGTB1_MOUSE Geranylgeranyl transferase type-1 subunit beta OS=Mus musculus GN=Pggt1b PE=1 SV=1 17 323 2.0E-29
sp|P49356|FNTB_HUMAN Protein farnesyltransferase subunit beta OS=Homo sapiens GN=FNTB PE=1 SV=1 45 313 3.0E-29
sp|Q55DA3|PGTB1_DICDI Geranylgeranyl transferase type-1 subunit beta OS=Dictyostelium discoideum GN=pggt1b PE=2 SV=1 91 317 4.0E-29
sp|Q5EAD5|PGTB1_BOVIN Geranylgeranyl transferase type-1 subunit beta OS=Bos taurus GN=PGGT1B PE=2 SV=1 17 323 4.0E-29
sp|P53610|PGTB1_RAT Geranylgeranyl transferase type-1 subunit beta OS=Rattus norvegicus GN=Pggt1b PE=1 SV=1 17 323 6.0E-29
sp|Q02293|FNTB_RAT Protein farnesyltransferase subunit beta OS=Rattus norvegicus GN=Fntb PE=1 SV=1 45 321 3.0E-28
sp|Q8K2I1|FNTB_MOUSE Protein farnesyltransferase subunit beta OS=Mus musculus GN=Fntb PE=1 SV=1 45 321 4.0E-28
sp|Q55D51|FNTB_DICDI Protein farnesyltransferase subunit beta OS=Dictyostelium discoideum GN=fntB PE=3 SV=1 85 303 4.0E-28
sp|P49355|FNTB_BOVIN Protein farnesyltransferase subunit beta OS=Bos taurus GN=FNTB PE=2 SV=1 45 313 1.0E-27
sp|O80642|PGTB1_ARATH Geranylgeranyl transferase type-1 subunit beta OS=Arabidopsis thaliana GN=GGB PE=1 SV=1 87 316 2.0E-27
sp|P22007|FNTB_YEAST Protein farnesyltransferase subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAM1 PE=1 SV=2 44 324 3.0E-27
sp|Q04903|FNTB_PEA Protein farnesyltransferase subunit beta OS=Pisum sativum GN=FTB PE=1 SV=1 45 263 5.0E-23
sp|P32434|PGTB1_SCHPO Geranylgeranyl transferase type-1 subunit beta OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwg2 PE=3 SV=1 139 299 6.0E-23
sp|Q38920|FNTB_ARATH Protein farnesyltransferase subunit beta OS=Arabidopsis thaliana GN=FTB PE=1 SV=3 45 256 2.0E-16
sp|P18898|PGTB1_YEAST Geranylgeranyl transferase type-1 subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC43 PE=1 SV=2 98 326 9.0E-14
sp|Q38920|FNTB_ARATH Protein farnesyltransferase subunit beta OS=Arabidopsis thaliana GN=FTB PE=1 SV=3 147 301 9.0E-07
sp|Q55DA3|PGTB1_DICDI Geranylgeranyl transferase type-1 subunit beta OS=Dictyostelium discoideum GN=pggt1b PE=2 SV=1 59 222 2.0E-06
sp|Q04903|FNTB_PEA Protein farnesyltransferase subunit beta OS=Pisum sativum GN=FTB PE=1 SV=1 165 302 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 62 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3008
MLSKSSSQNSKLAIQAHVKYIQSLDTKRDELDYWLTEHLRLNGVYWGLIALHLLARPEALSRQETIDFVFSCQHQ
SGGFGAAPDHDAHMLSTVSAVQILSMVGALDELDRRGPGKGSVGKYIADLQNRQTGSFCGDAWGEEDTRFLYGAF
NALSLLGLLSMVNVDKAVAYIASCANFDGGYGVRPGAESHSGQVFTCLAALSIAGRLDTIDQEKLACWLSERQTP
AGGLNGRPEKKEDVCYSWWVLSSLAMINRTHWIDREALVSFILDSQDTESGGISDRPGDMVDAWHTCFGIAGLSL
LGYPGLEAVDPVYCMPKTTIEQLVRR*
Coding >OphauB2|3008
ATGCTGAGCAAGTCGTCGTCTCAAAACTCCAAACTTGCCATTCAAGCTCATGTGAAATACATTCAAAGCTTGGAC
ACGAAAAGAGATGAACTCGATTACTGGTTGACAGAGCACCTGCGCCTCAACGGCGTATACTGGGGTTTGATTGCC
CTTCATCTGCTCGCACGGCCTGAGGCCCTATCTAGACAGGAGACAATCGACTTTGTGTTTTCCTGTCAGCATCAG
AGTGGCGGGTTTGGAGCAGCACCTGACCACGATGCCCACATGCTATCCACAGTTAGTGCTGTGCAGATTCTCTCC
ATGGTAGGCGCTTTAGACGAACTCGACCGTCGAGGTCCTGGCAAGGGGAGCGTGGGAAAATATATTGCAGATCTA
CAAAATCGCCAGACTGGCAGTTTTTGCGGCGATGCATGGGGCGAAGAAGATACACGTTTTCTATATGGCGCTTTC
AACGCCTTGTCACTGCTAGGTCTTTTGTCCATGGTCAATGTGGACAAGGCCGTTGCCTATATAGCATCATGTGCC
AATTTTGACGGCGGGTACGGTGTCAGGCCTGGTGCGGAGTCGCATTCGGGCCAGGTCTTCACATGTCTTGCGGCT
TTGAGTATTGCCGGTCGGCTCGATACGATTGACCAGGAGAAGCTAGCTTGTTGGCTCAGCGAGCGACAAACACCT
GCGGGCGGTCTCAATGGACGTCCCGAGAAGAAGGAGGATGTCTGCTATAGCTGGTGGGTGCTCAGCAGTCTTGCC
ATGATCAATCGAACACATTGGATCGACCGCGAAGCTCTTGTGAGCTTCATTCTCGACAGTCAAGATACCGAGTCG
GGTGGCATATCAGACCGACCTGGCGACATGGTTGACGCCTGGCACACGTGCTTTGGAATTGCAGGGCTAAGTCTT
CTTGGGTATCCCGGCTTAGAAGCCGTTGATCCTGTCTACTGCATGCCCAAGACAACAATTGAGCAACTAGTCAGA
AGATAG
Transcript >OphauB2|3008
ATGCTGAGCAAGTCGTCGTCTCAAAACTCCAAACTTGCCATTCAAGCTCATGTGAAATACATTCAAAGCTTGGAC
ACGAAAAGAGATGAACTCGATTACTGGTTGACAGAGCACCTGCGCCTCAACGGCGTATACTGGGGTTTGATTGCC
CTTCATCTGCTCGCACGGCCTGAGGCCCTATCTAGACAGGAGACAATCGACTTTGTGTTTTCCTGTCAGCATCAG
AGTGGCGGGTTTGGAGCAGCACCTGACCACGATGCCCACATGCTATCCACAGTTAGTGCTGTGCAGATTCTCTCC
ATGGTAGGCGCTTTAGACGAACTCGACCGTCGAGGTCCTGGCAAGGGGAGCGTGGGAAAATATATTGCAGATCTA
CAAAATCGCCAGACTGGCAGTTTTTGCGGCGATGCATGGGGCGAAGAAGATACACGTTTTCTATATGGCGCTTTC
AACGCCTTGTCACTGCTAGGTCTTTTGTCCATGGTCAATGTGGACAAGGCCGTTGCCTATATAGCATCATGTGCC
AATTTTGACGGCGGGTACGGTGTCAGGCCTGGTGCGGAGTCGCATTCGGGCCAGGTCTTCACATGTCTTGCGGCT
TTGAGTATTGCCGGTCGGCTCGATACGATTGACCAGGAGAAGCTAGCTTGTTGGCTCAGCGAGCGACAAACACCT
GCGGGCGGTCTCAATGGACGTCCCGAGAAGAAGGAGGATGTCTGCTATAGCTGGTGGGTGCTCAGCAGTCTTGCC
ATGATCAATCGAACACATTGGATCGACCGCGAAGCTCTTGTGAGCTTCATTCTCGACAGTCAAGATACCGAGTCG
GGTGGCATATCAGACCGACCTGGCGACATGGTTGACGCCTGGCACACGTGCTTTGGAATTGCAGGGCTAAGTCTT
CTTGGGTATCCCGGCTTAGAAGCCGTTGATCCTGTCTACTGCATGCCCAAGACAACAATTGAGCAACTAGTCAGA
AGATAG
Gene >OphauB2|3008
ATGCTGAGCAAGTCGTCGTCTCAAAACTCCAAACTTGCCATTCAAGCTCATGTGAAATACATTCAAAGCTTGGAC
ACGAAAAGAGATGAACTCGATTACTGGTTGACAGAGCACCTGCGCCTCAACGGCGTATACTGGGGTTTGATTGCC
CTTCATCTGCTCGCACGGCCTGAGGCCCTATCTAGACAGGAGACAATCGACTTTGTGTTTTCCTGTCAGCATCAG
AGTGGCGGGTTTGGAGCAGCACCTGACCACGATGCCCACATGCTATCCACAGTTAGTGCTGTGCAGATTCTCTCC
ATGGTAGGCGCTTTAGACGAACTCGACCGTCGAGGTCCTGGCAAGGGGAGCGTGGGAAAATGTGCGTGTTTTACT
ACCGCTCTTTGCAAACTTTGTAAGCGGCAGCTTGTGCTAACACGGGCAACAGATATTGCAGATCTACAAAATCGC
CAGACTGGCAGTTTTTGCGGCGATGCATGGGGCGAAGAAGATACACGTTTTCTATATGGCGCTTTCAACGCCTTG
TCACTGCTAGGTCTTTTGTCCATGGTCAATGTGGACAAGGCCGTTGCCTATATAGCATCATGTGCCAATTTTGAC
GGCGGGTACGGTGTCAGGCCTGGTGCGGAGTCGCATTCGGGCCAGGTCTTCACATGTCTTGCGGCTTTGAGTATT
GCCGGTCGGCTCGATACGATTGACCAGGAGAAGCTAGCTTGTTGGCTCAGCGAGCGACAAACACCTGCGGGCGGT
CTCAATGGACGTCCCGAGAAGAAGGAGGATGTCTGCTATAGCTGGTGGGTGCTCAGCAGTCTTGCCATGATCAAT
CGAACACATTGGATCGACCGCGAAGCTCTTGTGAGCTTCATTCTCGACAGTCAAGATACCGAGTCGGGTGGCATA
TCAGACCGACCTGGCGACATGGTTGACGCCTGGCACACGTGCTTTGGAATTGCAGGGCTAAGTCTTCTTGGGTAT
CCCGGCTTAGAAGCCGTTGATCCTGTCTACTGCATGCCCAAGACAACAATTGAGCAACTAGTCAGAAGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail