Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3007
Gene name
LocationContig_2:280884..282909
Strand-
Gene length (bp)2025
Transcript length (bp)1737
Coding sequence length (bp)1737
Protein length (aa) 579

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1427
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5457
Ophiocordyceps australis map64 (Brazil) OphauB2|3007 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|07142
Ophiocordyceps camponoti-rufipedis Ophun1|7107
Ophiocordyceps kimflemingae Ophio5|2704
Ophiocordyceps subramaniannii Hirsu2|1093

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3007
MASLATSGGSTLGSSGRQIPLLCSVCPEAPRFSDVSHLLTHIASKGHLHHETQTRLRRNQDLASLALLEQYEQWY
KDNGIEALLVERMKAKQQKEAAKARRVRGAALAPANKVKRKAKRRSPNSTSATPAKQAKLEQGDYIPDFPLFPGF
LPSENDVDNQDDVFVSTDMLALKGQVWPGMGKMDLANEDMKRTRNQRKPNSVIDKMRRTSEGIEPTQVVMTPDFE
VERIKGVYDSSSPIPGQEEETPKKVIKPKRKRSEVLAEVSVNVPRGGNRRSTRLSLASTNSSNSHKMKHLKLEYD
RDTSSDLTPSLGAFRHSHDIFRDDDGCPGSYADRSFATPTHREPKFDTRERLNMHSLNPMSHSIVVSPTPSSRDV
STRLLSARSRGPPRAYLGHGGPLSLGGLSQPETVYGLGDASMFGPPTRLAFAASPYNSLSQDGYRLLPSHLQAKQ
EDYSSTSSDSLSGSNSGSFLSMAETNPLFSQDRVFLSPYHPSNTNPPLSSMSFTPINRVQDHGHGSHDHDHRPQL
PDIKLENHMCDGIESSTCAEKQGGLSMHAMWDSHGPGSGVGIRPELNEDEIDL*
Coding >OphauB2|3007
ATGGCGTCGCTGGCCACTTCGGGTGGCAGCACGCTCGGCTCAAGCGGCAGACAGATCCCGCTGCTTTGCAGTGTC
TGTCCTGAAGCTCCGCGCTTCTCAGACGTCTCCCATCTCTTGACGCACATTGCTTCCAAGGGCCACCTTCACCAT
GAAACCCAGACGCGACTCAGACGAAACCAGGATCTGGCTTCGCTGGCTCTTTTGGAGCAGTATGAGCAGTGGTAC
AAGGATAATGGCATCGAGGCTTTGTTGGTGGAGAGGATGAAGGCAAAGCAGCAGAAGGAAGCTGCCAAGGCAAGG
CGCGTTCGTGGAGCCGCTTTGGCGCCCGCAAACAAAGTCAAGCGCAAGGCGAAGCGGCGTTCACCCAATTCCACC
AGTGCAACACCTGCCAAGCAGGCCAAGTTGGAGCAGGGCGACTACATACCAGACTTTCCTCTCTTTCCCGGATTT
CTTCCGTCTGAAAACGACGTGGACAATCAAGACGACGTCTTTGTAAGCACTGACATGCTTGCTCTCAAGGGCCAG
GTGTGGCCTGGCATGGGCAAGATGGATCTTGCCAATGAAGACATGAAGAGAACACGCAACCAGCGCAAGCCCAAT
TCTGTCATCGATAAGATGCGCAGAACCTCTGAAGGCATTGAACCCACGCAGGTGGTTATGACCCCTGATTTTGAG
GTTGAAAGGATCAAGGGAGTTTACGATAGCTCCTCTCCGATTCCTGGCCAAGAAGAAGAGACACCAAAGAAGGTG
ATTAAGCCCAAGCGCAAGAGGTCCGAGGTGCTCGCAGAAGTCTCCGTAAACGTTCCTCGTGGCGGAAACCGACGC
TCGACTCGTCTTAGTCTGGCGAGCACTAATAGCAGTAACAGCCACAAAATGAAGCATCTCAAGCTCGAATATGAC
CGCGATACAAGCTCCGATCTGACTCCATCCCTCGGCGCATTCCGCCATAGTCACGACATCTTCCGCGACGATGAT
GGATGTCCTGGCTCATATGCGGACCGTTCCTTTGCGACGCCTACTCATCGAGAACCCAAGTTCGACACTCGAGAG
CGATTAAACATGCATTCTCTAAATCCCATGTCCCACTCTATTGTTGTCTCACCTACACCCTCGTCGAGAGACGTG
TCGACTCGTCTCCTGTCGGCGAGAAGCAGAGGTCCGCCACGCGCATATCTTGGTCATGGCGGCCCTTTGTCTCTA
GGCGGCTTGTCACAGCCCGAGACAGTGTATGGCCTCGGAGATGCATCCATGTTTGGTCCCCCAACAAGACTTGCC
TTTGCTGCAAGTCCTTACAACAGCCTATCGCAAGATGGATATCGCCTCCTCCCTAGTCATCTGCAGGCCAAGCAG
GAGGACTATTCGTCGACAAGCAGTGACTCGCTATCCGGGTCCAACAGTGGATCTTTCTTGTCAATGGCTGAGACG
AACCCACTCTTCTCTCAGGATCGAGTTTTTTTATCTCCATATCACCCATCCAACACTAACCCGCCTCTATCATCC
ATGAGTTTCACTCCTATCAACAGAGTCCAGGATCACGGTCATGGATCTCACGATCATGATCACCGGCCACAGCTA
CCCGATATCAAGCTCGAAAATCACATGTGCGATGGCATCGAGAGCAGCACTTGTGCAGAAAAGCAGGGCGGATTA
TCCATGCACGCCATGTGGGACTCACATGGACCTGGTAGCGGTGTTGGCATTCGCCCTGAGCTCAATGAAGACGAG
ATCGACTTATAA
Transcript >OphauB2|3007
ATGGCGTCGCTGGCCACTTCGGGTGGCAGCACGCTCGGCTCAAGCGGCAGACAGATCCCGCTGCTTTGCAGTGTC
TGTCCTGAAGCTCCGCGCTTCTCAGACGTCTCCCATCTCTTGACGCACATTGCTTCCAAGGGCCACCTTCACCAT
GAAACCCAGACGCGACTCAGACGAAACCAGGATCTGGCTTCGCTGGCTCTTTTGGAGCAGTATGAGCAGTGGTAC
AAGGATAATGGCATCGAGGCTTTGTTGGTGGAGAGGATGAAGGCAAAGCAGCAGAAGGAAGCTGCCAAGGCAAGG
CGCGTTCGTGGAGCCGCTTTGGCGCCCGCAAACAAAGTCAAGCGCAAGGCGAAGCGGCGTTCACCCAATTCCACC
AGTGCAACACCTGCCAAGCAGGCCAAGTTGGAGCAGGGCGACTACATACCAGACTTTCCTCTCTTTCCCGGATTT
CTTCCGTCTGAAAACGACGTGGACAATCAAGACGACGTCTTTGTAAGCACTGACATGCTTGCTCTCAAGGGCCAG
GTGTGGCCTGGCATGGGCAAGATGGATCTTGCCAATGAAGACATGAAGAGAACACGCAACCAGCGCAAGCCCAAT
TCTGTCATCGATAAGATGCGCAGAACCTCTGAAGGCATTGAACCCACGCAGGTGGTTATGACCCCTGATTTTGAG
GTTGAAAGGATCAAGGGAGTTTACGATAGCTCCTCTCCGATTCCTGGCCAAGAAGAAGAGACACCAAAGAAGGTG
ATTAAGCCCAAGCGCAAGAGGTCCGAGGTGCTCGCAGAAGTCTCCGTAAACGTTCCTCGTGGCGGAAACCGACGC
TCGACTCGTCTTAGTCTGGCGAGCACTAATAGCAGTAACAGCCACAAAATGAAGCATCTCAAGCTCGAATATGAC
CGCGATACAAGCTCCGATCTGACTCCATCCCTCGGCGCATTCCGCCATAGTCACGACATCTTCCGCGACGATGAT
GGATGTCCTGGCTCATATGCGGACCGTTCCTTTGCGACGCCTACTCATCGAGAACCCAAGTTCGACACTCGAGAG
CGATTAAACATGCATTCTCTAAATCCCATGTCCCACTCTATTGTTGTCTCACCTACACCCTCGTCGAGAGACGTG
TCGACTCGTCTCCTGTCGGCGAGAAGCAGAGGTCCGCCACGCGCATATCTTGGTCATGGCGGCCCTTTGTCTCTA
GGCGGCTTGTCACAGCCCGAGACAGTGTATGGCCTCGGAGATGCATCCATGTTTGGTCCCCCAACAAGACTTGCC
TTTGCTGCAAGTCCTTACAACAGCCTATCGCAAGATGGATATCGCCTCCTCCCTAGTCATCTGCAGGCCAAGCAG
GAGGACTATTCGTCGACAAGCAGTGACTCGCTATCCGGGTCCAACAGTGGATCTTTCTTGTCAATGGCTGAGACG
AACCCACTCTTCTCTCAGGATCGAGTTTTTTTATCTCCATATCACCCATCCAACACTAACCCGCCTCTATCATCC
ATGAGTTTCACTCCTATCAACAGAGTCCAGGATCACGGTCATGGATCTCACGATCATGATCACCGGCCACAGCTA
CCCGATATCAAGCTCGAAAATCACATGTGCGATGGCATCGAGAGCAGCACTTGTGCAGAAAAGCAGGGCGGATTA
TCCATGCACGCCATGTGGGACTCACATGGACCTGGTAGCGGTGTTGGCATTCGCCCTGAGCTCAATGAAGACGAG
ATCGACTTATAA
Gene >OphauB2|3007
ATGGCGTCGCTGGCCACTTCGGGTGGCAGCACGCTCGGCTCAAGCGGCAGACAGATCCCGCTGCTTTGCAGTGTC
TGTCCTGAAGCTCCGCGCTTCTCAGACGTCTCCCATCTCTTGACGCACATTGCTTCCAAGGGCCACCTTCACCAT
GAAACCCAGACGCGACTCAGACGAAACCAGGATCTGGCTTCGCTGGCTCTTTTGGAGCAGTATGAGCAGTGGTAC
AAGGATAATGGCATCGAGGCTTTGTTGGTGGAGAGGATGAAGGCAAAGCAGCAGAAGGAAGCTGCCAAGGCAAGG
CGCGTTCGTGGAGCCGCTTTGGCGCCCGCAAACAAAGTTGGTTCTCCGTCTTGGGTCTTGACAGTCAGTGCCAAC
CTAATATGTGTAATAGGTCAAGCGCAAGGCGAAGCGGCGTTCACCCAATTCCACCAGTGCAACACCTGCCAAGCA
GGCCAAGTTGGAGCAGGGCGACTACATACCAGACTTTCCTCTCTTTCCCGGATTTCTTCCGTCTGAAAACGACGT
GGACAATCAAGACGACGTCTTTGTAAGCACTGACATGCTTGCTCTCAAGGGCCAGGTGTGGCCTGGCATGGGCAA
GATGGATCTTGCCAATGAAGACATGAAGAGAACACGCAACCAGCGCAAGCCCAATTCTGTCATCGATAAGATGCG
CAGAACCTCTGAAGGCATTGAACCCACGCAGGTGGTTATGACCCCTGATTTTGAGGTTGAAAGGATCAAGGGAGT
TTACGATAGCTCCTCTCCGATTCCTGGCCAAGAAGAAGAGGTGTGTGTGCCGCGTCAGTGGCTCGCTCTATGAGA
GCCTCACTCAGCTCATGGTTTCCAGACACCAAAGAAGGTGATTAAGCCCAAGCGCAAGAGGTCCGAGGTGCTCGC
AGAAGTCTCCGTAAACGTTCCTCGTGGCGGAAACCGACGCTCGACTCGTCTTAGTCTGGCGAGCACTAATAGCAG
TAACAGCCACAAAATGAAGCATCTCAAGCTCGAATATGACCGCGATACAAGCTCCGATCTGACTCCATCCCTCGG
CGCATTCCGCCATAGTCACGACATCTTCCGCGACGATGATGGATGTCCTGGTATGCGCTCTTGTTCATTTCCACA
TCAAATTTCTGACCTGATGTAGGCTCATATGCGGACCGTTCCTTTGCGACGCCTACTCATCGAGAACCCAAGTAT
GCGCTTTGCTGTCGATTGTTGATTTGGAGCCAGCGCTTACCAGGCATCAGGTTCGACACTCGAGAGCGATTAAAC
ATGCATTCTCTAAATCCCATGTCCCACTCTATTGTTGTCTCACCTACACCCTCGTCGAGAGACGTGTCGACTCGT
CTCCTGTCGGCGAGAAGCAGAGGTCCGCCACGCGCATATCTTGGTCATGGCGGCCCTTTGTCTCTAGGTAGGACA
AGCTTGAATCTTCCCAAAAATTGCTTCTTTTCTTGTATGGAACGTCTTTTTGACAGAAGCACAGGCGGCTTGTCA
CAGCCCGAGACAGTGTATGGCCTCGGAGATGCATCCATGTTTGGTCCCCCAACAAGACTTGCCTTTGCTGCAAGT
CCTTACAACAGCCTATCGCAAGATGGATATCGCCTCCTCCCTAGTCATCTGCAGGCCAAGCAGGAGGACTATTCG
TCGACAAGCAGTGACTCGCTATCCGGGTCCAACAGTGGATCTTTCTTGTCAATGGCTGAGACGAACCCACTCTTC
TCTCAGGATCGAGTTTTTTTATCTCCATATCACCCATCCAACACTAACCCGCCTCTATCATCCATGAGTTTCACT
CCTATCAACAGAGTCCAGGATCACGGTCATGGATCTCACGATCATGATCACCGGCCACAGCTACCCGATATCAAG
CTCGAAAATCACATGTGCGATGGCATCGAGAGCAGCACTTGTGCAGAAAAGCAGGGCGGATTATCCATGCACGCC
ATGTGGGACTCACATGGACCTGGTAGCGGTGTTGGCATTCGCCCTGAGCTCAATGAAGACGAGATCGACTTATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail