Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|30
Gene name
LocationContig_1:72627..74116
Strand+
Gene length (bp)1489
Transcript length (bp)1356
Coding sequence length (bp)1356
Protein length (aa) 452

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02535 Zip ZIP Zinc transporter 4.6E-52 50 447

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12436|ZRT2_YEAST Zinc-regulated transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZRT2 PE=1 SV=1 23 451 3.0E-48
sp|O94639|ZRT1_SCHPO Zinc-regulated transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zrt1 PE=1 SV=1 24 451 6.0E-38
sp|P32804|ZRT1_YEAST Zinc-regulated transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZRT1 PE=1 SV=1 222 451 9.0E-32
sp|Q8W246|ZIP7_ARATH Zinc transporter 7 OS=Arabidopsis thaliana GN=ZIP7 PE=2 SV=1 225 451 2.0E-25
sp|A3BI11|ZIP8_ORYSJ Zinc transporter 8 OS=Oryza sativa subsp. japonica GN=ZIP8 PE=2 SV=1 298 451 3.0E-24
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12436|ZRT2_YEAST Zinc-regulated transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZRT2 PE=1 SV=1 23 451 3.0E-48
sp|O94639|ZRT1_SCHPO Zinc-regulated transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zrt1 PE=1 SV=1 24 451 6.0E-38
sp|P32804|ZRT1_YEAST Zinc-regulated transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZRT1 PE=1 SV=1 222 451 9.0E-32
sp|Q8W246|ZIP7_ARATH Zinc transporter 7 OS=Arabidopsis thaliana GN=ZIP7 PE=2 SV=1 225 451 2.0E-25
sp|A3BI11|ZIP8_ORYSJ Zinc transporter 8 OS=Oryza sativa subsp. japonica GN=ZIP8 PE=2 SV=1 298 451 3.0E-24
sp|Q6L8G0|ZIP5_ORYSJ Zinc transporter 5 OS=Oryza sativa subsp. japonica GN=ZIP5 PE=2 SV=1 286 451 1.0E-20
sp|O23039|ZIP5_ARATH Zinc transporter 5 OS=Arabidopsis thaliana GN=ZIP5 PE=2 SV=1 225 451 4.0E-20
sp|Q9SLG3|ZIP3_ARATH Zinc transporter 3 OS=Arabidopsis thaliana GN=ZIP3 PE=2 SV=1 272 451 2.0E-19
sp|Q75HB1|IRT1_ORYSJ Fe(2+) transport protein 1 OS=Oryza sativa subsp. japonica GN=IRT1 PE=2 SV=1 268 451 2.0E-19
sp|Q6L8F9|ZIP6_ORYSJ Zinc transporter 6 OS=Oryza sativa subsp. japonica GN=ZIP6 PE=2 SV=1 52 451 2.0E-19
sp|Q6L8F7|ZIP7_ORYSJ Zinc transporter 7 OS=Oryza sativa subsp. japonica GN=ZIP7 PE=2 SV=1 267 451 4.0E-19
sp|Q5Z653|ZIP10_ORYSJ Zinc transporter 10 OS=Oryza sativa subsp. japonica GN=ZIP10 PE=3 SV=2 291 420 5.0E-19
sp|Q38856|IRT1_ARATH Fe(2+) transport protein 1 OS=Arabidopsis thaliana GN=IRT1 PE=1 SV=2 276 445 5.0E-19
sp|Q8W245|ZIP10_ARATH Probable zinc transporter 10 OS=Arabidopsis thaliana GN=ZIP10 PE=1 SV=2 288 451 1.0E-18
sp|Q9FIS2|ZIP12_ARATH Probable zinc transporter 12 OS=Arabidopsis thaliana GN=ZIP12 PE=3 SV=1 241 451 2.0E-18
sp|O04089|ZIP4_ARATH Zinc transporter 4, chloroplastic OS=Arabidopsis thaliana GN=ZIP4 PE=2 SV=1 287 451 2.0E-18
sp|O82643|ZIP9_ARATH Zinc transporter 9 OS=Arabidopsis thaliana GN=ZIP9 PE=2 SV=1 291 420 2.0E-18
sp|Q8LE59|IRT3_ARATH Fe(2+) transport protein 3, chloroplastic OS=Arabidopsis thaliana GN=IRT3 PE=2 SV=3 291 451 3.0E-18
sp|Q7XLD4|ZIP3_ORYSJ Zinc transporter 3 OS=Oryza sativa subsp. japonica GN=ZIP3 PE=1 SV=2 298 451 5.0E-18
sp|Q6L8G1|IRT2_ORYSJ Fe(2+) transport protein 2 OS=Oryza sativa subsp. japonica GN=IRT2 PE=2 SV=1 283 451 3.0E-17
sp|Q8S3W4|ZIP8_ARATH Probable zinc transporter 8 OS=Arabidopsis thaliana GN=ZIP8 PE=2 SV=1 281 426 3.0E-17
sp|O81850|IRT2_ARATH Fe(2+) transport protein 2 OS=Arabidopsis thaliana GN=IRT2 PE=1 SV=1 260 451 3.0E-17
sp|O64738|ZIP6_ARATH Zinc transporter 6, chloroplastic OS=Arabidopsis thaliana GN=ZIP6 PE=3 SV=1 279 451 9.0E-17
sp|O81123|ZIP1_ARATH Zinc transporter 1 OS=Arabidopsis thaliana GN=ZIP1 PE=2 SV=1 291 451 5.0E-15
sp|Q6ZJ91|ZIP4_ORYSJ Zinc transporter 4 OS=Oryza sativa subsp. japonica GN=ZIP4 PE=2 SV=1 298 451 6.0E-15
sp|Q0DHE3|ZIP9_ORYSJ Zinc transporter 9 OS=Oryza sativa subsp. japonica GN=ZIP9 PE=3 SV=3 325 451 5.0E-12
sp|O81123|ZIP1_ARATH Zinc transporter 1 OS=Arabidopsis thaliana GN=ZIP1 PE=2 SV=1 52 174 2.0E-10
sp|Q0DHE3|ZIP9_ORYSJ Zinc transporter 9 OS=Oryza sativa subsp. japonica GN=ZIP9 PE=3 SV=3 50 146 3.0E-09
sp|O23039|ZIP5_ARATH Zinc transporter 5 OS=Arabidopsis thaliana GN=ZIP5 PE=2 SV=1 23 146 3.0E-09
sp|A3BI11|ZIP8_ORYSJ Zinc transporter 8 OS=Oryza sativa subsp. japonica GN=ZIP8 PE=2 SV=1 49 146 3.0E-09
sp|Q6L8G0|ZIP5_ORYSJ Zinc transporter 5 OS=Oryza sativa subsp. japonica GN=ZIP5 PE=2 SV=1 33 160 1.0E-08
sp|Q9FIS2|ZIP12_ARATH Probable zinc transporter 12 OS=Arabidopsis thaliana GN=ZIP12 PE=3 SV=1 33 144 2.0E-08
sp|Q9SLG3|ZIP3_ARATH Zinc transporter 3 OS=Arabidopsis thaliana GN=ZIP3 PE=2 SV=1 66 146 1.0E-07
sp|Q8W246|ZIP7_ARATH Zinc transporter 7 OS=Arabidopsis thaliana GN=ZIP7 PE=2 SV=1 49 144 4.0E-07
sp|O04089|ZIP4_ARATH Zinc transporter 4, chloroplastic OS=Arabidopsis thaliana GN=ZIP4 PE=2 SV=1 32 136 7.0E-07
sp|Q7XLD4|ZIP3_ORYSJ Zinc transporter 3 OS=Oryza sativa subsp. japonica GN=ZIP3 PE=1 SV=2 30 172 9.0E-07
sp|Q8LE59|IRT3_ARATH Fe(2+) transport protein 3, chloroplastic OS=Arabidopsis thaliana GN=IRT3 PE=2 SV=3 67 142 2.0E-06
sp|Q8W245|ZIP10_ARATH Probable zinc transporter 10 OS=Arabidopsis thaliana GN=ZIP10 PE=1 SV=2 56 147 2.0E-06
sp|Q8S3W4|ZIP8_ARATH Probable zinc transporter 8 OS=Arabidopsis thaliana GN=ZIP8 PE=2 SV=1 49 147 2.0E-06
sp|Q38856|IRT1_ARATH Fe(2+) transport protein 1 OS=Arabidopsis thaliana GN=IRT1 PE=1 SV=2 49 147 3.0E-06
sp|O81850|IRT2_ARATH Fe(2+) transport protein 2 OS=Arabidopsis thaliana GN=IRT2 PE=1 SV=1 50 159 4.0E-06
sp|Q75HB1|IRT1_ORYSJ Fe(2+) transport protein 1 OS=Oryza sativa subsp. japonica GN=IRT1 PE=2 SV=1 49 145 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0046873 metal ion transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0016020 membrane Yes
GO:0030001 metal ion transport Yes
GO:0051179 localization No
GO:0006811 ion transport No
GO:0008324 cation transmembrane transporter activity No
GO:0005575 cellular_component No
GO:0006812 cation transport No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0015075 ion transmembrane transporter activity No
GO:0015318 inorganic molecular entity transmembrane transporter activity No
GO:0022890 inorganic cation transmembrane transporter activity No
GO:0110165 cellular anatomical entity No
GO:0006810 transport No
GO:0022857 transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0009987 cellular process No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 47 69 22
2 81 103 22
3 123 145 22
4 307 329 22
5 354 376 22
6 389 411 22
7 431 450 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|30
MDGATQSKDISWTSISTTLILEELRRREDEGTKTQCGSNRTGWYDTVAHVFALLLILTLSTLACGFPLISRRTTT
GKRQKTIIFYCQHAGTGVLLATAFVHLLPTAFESLTDPCLPHFFSKGYKPLPGLVAMVSAIIVVGVESYLTERGA
GHSHSHAHGFFEDADETNNEGHFHHVDFAATSSVPGLALRRPSSHRPTNISVDDLDMTQGLVAGVSPLPESTPVY
AQRKVARSEQGDGDGDDSDLELEMNELDASTASNGHDGSYSHLAKPNGRQAESSDLPVQTPEGQKRQLLQCLLLE
AGILFHSVFIGMAISVATGPAFVVFLVAISFHQSFEGLALGSRIAAIQFPRNSIRPWLMVLAYGLTTPLGQAIGL
IVHKMYDPASMAGLLVVGFMNAVSSGLLLYAGLVQLLAEDFLTEKSYRVLKGKKRLHAYLAVVGGAVLMALVGAF
A*
Coding >OphauB2|30
ATGGACGGGGCGACTCAAAGCAAAGACATATCGTGGACGTCGATATCCACGACATTGATTCTCGAAGAGCTGCGA
CGGCGCGAGGACGAGGGCACCAAAACTCAATGCGGCTCCAACAGGACAGGATGGTACGACACGGTAGCACACGTT
TTTGCTCTCCTGTTGATTCTAACACTGAGCACGCTGGCCTGCGGCTTCCCCCTCATCTCACGCCGGACTACGACG
GGCAAGCGACAAAAGACCATCATCTTTTACTGTCAACATGCCGGTACTGGCGTCTTGCTGGCAACAGCCTTTGTG
CATTTGCTGCCGACAGCATTCGAGTCCCTTACGGATCCATGCCTGCCGCACTTTTTCAGCAAGGGCTACAAGCCG
CTTCCAGGGCTCGTTGCCATGGTTTCGGCCATTATTGTCGTGGGCGTCGAGTCGTACCTGACGGAGCGGGGGGCG
GGCCATTCACATTCACACGCACACGGCTTCTTTGAAGACGCAGACGAAACAAACAACGAGGGACACTTCCACCAT
GTTGACTTTGCCGCTACAAGCAGTGTACCCGGCCTGGCCCTTAGGAGGCCAAGTAGTCATCGACCGACAAACATT
TCAGTAGATGACTTGGACATGACTCAGGGGCTAGTCGCTGGTGTCTCGCCGTTGCCAGAGTCGACACCTGTGTAT
GCGCAACGCAAAGTGGCACGGTCGGAACAAGGTGACGGCGACGGCGACGATTCCGACTTGGAACTCGAAATGAAC
GAGCTGGATGCTTCCACGGCTAGCAATGGGCATGACGGATCCTATTCGCATCTTGCCAAGCCCAACGGGCGACAG
GCAGAGTCGTCGGATTTGCCGGTGCAAACGCCAGAAGGGCAGAAGCGGCAGCTATTGCAATGCCTTCTTCTTGAA
GCGGGCATCCTGTTTCACAGCGTCTTCATCGGCATGGCCATCTCGGTGGCCACAGGTCCCGCGTTTGTCGTTTTC
CTCGTGGCAATTAGCTTTCACCAGTCATTTGAAGGGCTGGCGCTGGGCAGCCGCATCGCCGCGATTCAGTTTCCA
CGCAATTCAATCCGGCCGTGGCTCATGGTGCTGGCATACGGACTGACTACGCCGCTAGGGCAGGCTATTGGGCTC
ATTGTGCACAAGATGTACGACCCAGCGTCAATGGCAGGCTTACTTGTTGTTGGCTTCATGAATGCCGTGTCATCG
GGCCTGCTGCTTTACGCTGGGCTAGTGCAGCTACTTGCCGAGGACTTTCTGACAGAAAAAAGCTACAGAGTGCTC
AAGGGCAAGAAGAGGCTGCACGCGTACCTGGCGGTTGTAGGTGGCGCAGTGCTAATGGCCCTAGTCGGAGCTTTT
GCCTGA
Transcript >OphauB2|30
ATGGACGGGGCGACTCAAAGCAAAGACATATCGTGGACGTCGATATCCACGACATTGATTCTCGAAGAGCTGCGA
CGGCGCGAGGACGAGGGCACCAAAACTCAATGCGGCTCCAACAGGACAGGATGGTACGACACGGTAGCACACGTT
TTTGCTCTCCTGTTGATTCTAACACTGAGCACGCTGGCCTGCGGCTTCCCCCTCATCTCACGCCGGACTACGACG
GGCAAGCGACAAAAGACCATCATCTTTTACTGTCAACATGCCGGTACTGGCGTCTTGCTGGCAACAGCCTTTGTG
CATTTGCTGCCGACAGCATTCGAGTCCCTTACGGATCCATGCCTGCCGCACTTTTTCAGCAAGGGCTACAAGCCG
CTTCCAGGGCTCGTTGCCATGGTTTCGGCCATTATTGTCGTGGGCGTCGAGTCGTACCTGACGGAGCGGGGGGCG
GGCCATTCACATTCACACGCACACGGCTTCTTTGAAGACGCAGACGAAACAAACAACGAGGGACACTTCCACCAT
GTTGACTTTGCCGCTACAAGCAGTGTACCCGGCCTGGCCCTTAGGAGGCCAAGTAGTCATCGACCGACAAACATT
TCAGTAGATGACTTGGACATGACTCAGGGGCTAGTCGCTGGTGTCTCGCCGTTGCCAGAGTCGACACCTGTGTAT
GCGCAACGCAAAGTGGCACGGTCGGAACAAGGTGACGGCGACGGCGACGATTCCGACTTGGAACTCGAAATGAAC
GAGCTGGATGCTTCCACGGCTAGCAATGGGCATGACGGATCCTATTCGCATCTTGCCAAGCCCAACGGGCGACAG
GCAGAGTCGTCGGATTTGCCGGTGCAAACGCCAGAAGGGCAGAAGCGGCAGCTATTGCAATGCCTTCTTCTTGAA
GCGGGCATCCTGTTTCACAGCGTCTTCATCGGCATGGCCATCTCGGTGGCCACAGGTCCCGCGTTTGTCGTTTTC
CTCGTGGCAATTAGCTTTCACCAGTCATTTGAAGGGCTGGCGCTGGGCAGCCGCATCGCCGCGATTCAGTTTCCA
CGCAATTCAATCCGGCCGTGGCTCATGGTGCTGGCATACGGACTGACTACGCCGCTAGGGCAGGCTATTGGGCTC
ATTGTGCACAAGATGTACGACCCAGCGTCAATGGCAGGCTTACTTGTTGTTGGCTTCATGAATGCCGTGTCATCG
GGCCTGCTGCTTTACGCTGGGCTAGTGCAGCTACTTGCCGAGGACTTTCTGACAGAAAAAAGCTACAGAGTGCTC
AAGGGCAAGAAGAGGCTGCACGCGTACCTGGCGGTTGTAGGTGGCGCAGTGCTAATGGCCCTAGTCGGAGCTTTT
GCCTGA
Gene >OphauB2|30
ATGGACGGGGCGACTCAAAGCAAAGGTATTGATGCGTGATTATCGAGGCGATGACCAGCAGCTGACGGCTTGCTT
CCATCAGACATATCGTGGACGTCGATATCCACGACATTGATTCTCGAAGAGCTGCGACGGCGCGAGGACGAGGGC
ACCAAAACTCAATGCGGCTCCAACAGGACAGGATGGTACGACACGGTAGCACACGTTTTTGCTCTCCTGTTGATT
CTAACACTGAGCACGCTGGGTGAGCAAGACCATGCTGGCCCTTTTGTCATTTGGCTCGTCGTGTCACTGCTCCGT
ATCCTGACTTTGATGCACAGCCTGCGGCTTCCCCCTCATCTCACGCCGGACTACGACGGGCAAGCGACAAAAGAC
CATCATCTTTTACTGTCAACATGCCGGTACTGGCGTCTTGCTGGCAACAGCCTTTGTGCATTTGCTGCCGACAGC
ATTCGAGTCCCTTACGGATCCATGCCTGCCGCACTTTTTCAGCAAGGGCTACAAGCCGCTTCCAGGGCTCGTTGC
CATGGTTTCGGCCATTATTGTCGTGGGCGTCGAGTCGTACCTGACGGAGCGGGGGGCGGGCCATTCACATTCACA
CGCACACGGCTTCTTTGAAGACGCAGACGAAACAAACAACGAGGGACACTTCCACCATGTTGACTTTGCCGCTAC
AAGCAGTGTACCCGGCCTGGCCCTTAGGAGGCCAAGTAGTCATCGACCGACAAACATTTCAGTAGATGACTTGGA
CATGACTCAGGGGCTAGTCGCTGGTGTCTCGCCGTTGCCAGAGTCGACACCTGTGTATGCGCAACGCAAAGTGGC
ACGGTCGGAACAAGGTGACGGCGACGGCGACGATTCCGACTTGGAACTCGAAATGAACGAGCTGGATGCTTCCAC
GGCTAGCAATGGGCATGACGGATCCTATTCGCATCTTGCCAAGCCCAACGGGCGACAGGCAGAGTCGTCGGATTT
GCCGGTGCAAACGCCAGAAGGGCAGAAGCGGCAGCTATTGCAATGCCTTCTTCTTGAAGCGGGCATCCTGTTTCA
CAGCGTCTTCATCGGCATGGCCATCTCGGTGGCCACAGGTCCCGCGTTTGTCGTTTTCCTCGTGGCAATTAGCTT
TCACCAGTCATTTGAAGGGCTGGCGCTGGGCAGCCGCATCGCCGCGATTCAGTTTCCACGCAATTCAATCCGGCC
GTGGCTCATGGTGCTGGCATACGGACTGACTACGCCGCTAGGGCAGGCTATTGGGCTCATTGTGCACAAGATGTA
CGACCCAGCGTCAATGGCAGGCTTACTTGTTGTTGGCTTCATGAATGCCGTGTCATCGGGCCTGCTGCTTTACGC
TGGGCTAGTGCAGCTACTTGCCGAGGACTTTCTGACAGAAAAAAGCTACAGAGTGCTCAAGGGCAAGAAGAGGCT
GCACGCGTACCTGGCGGTTGTAGGTGGCGCAGTGCTAATGGCCCTAGTCGGAGCTTTTGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail