Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|3
Gene name
LocationContig_1:6169..7739
Strand+
Gene length (bp)1570
Transcript length (bp)1146
Coding sequence length (bp)1146
Protein length (aa) 382

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00735 Septin Septin 1.3E-106 16 294
PF01926 MMR_HSR1 50S ribosome-binding GTPase 9.2E-05 23 155

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P48008|SPN3_SCHPO Septin homolog spn3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spn3 PE=1 SV=3 11 362 5.0E-129
sp|P32458|CDC11_YEAST Cell division control protein 11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC11 PE=1 SV=1 5 366 1.0E-117
sp|G1UB61|CDC11_CANAL Septin CDC11 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDC11 PE=1 SV=1 1 381 7.0E-94
sp|Q59VX8|SHS1_CANAL Septation protein 7 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SEP7 PE=1 SV=1 2 293 4.0E-88
sp|P42207|SEPT1_DROME Septin-1 OS=Drosophila melanogaster GN=Sep1 PE=1 SV=1 11 330 2.0E-83
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P48008|SPN3_SCHPO Septin homolog spn3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spn3 PE=1 SV=3 11 362 5.0E-129
sp|P32458|CDC11_YEAST Cell division control protein 11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC11 PE=1 SV=1 5 366 1.0E-117
sp|G1UB61|CDC11_CANAL Septin CDC11 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDC11 PE=1 SV=1 1 381 7.0E-94
sp|Q59VX8|SHS1_CANAL Septation protein 7 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SEP7 PE=1 SV=1 2 293 4.0E-88
sp|P42207|SEPT1_DROME Septin-1 OS=Drosophila melanogaster GN=Sep1 PE=1 SV=1 11 330 2.0E-83
sp|O43236|SEPT4_HUMAN Septin-4 OS=Homo sapiens GN=SEPT4 PE=1 SV=1 11 338 5.0E-83
sp|Q4R4X5|SEPT4_MACFA Septin-4 OS=Macaca fascicularis GN=SEPT4 PE=2 SV=1 11 343 5.0E-83
sp|Q5R6R7|SEPT4_PONAB Septin-4 OS=Pongo abelii GN=SEPT4 PE=2 SV=1 11 338 8.0E-83
sp|P28661|SEPT4_MOUSE Septin-4 OS=Mus musculus GN=Sept4 PE=1 SV=1 11 343 2.0E-82
sp|Q9BGQ3|SEPT5_MACFA Septin-5 OS=Macaca fascicularis GN=Sept5 PE=2 SV=1 11 338 2.0E-81
sp|Q99719|SEPT5_HUMAN Septin-5 OS=Homo sapiens GN=SEPT5 PE=1 SV=1 11 338 7.0E-81
sp|Q6Q137|SEPT7_BOVIN Septin-7 OS=Bos taurus GN=SEPT7 PE=2 SV=2 11 375 1.0E-80
sp|Q5R1W1|SEPT7_PANTR Septin-7 (Fragment) OS=Pan troglodytes GN=SEPT7 PE=2 SV=2 11 375 1.0E-80
sp|Q16181|SEPT7_HUMAN Septin-7 OS=Homo sapiens GN=SEPT7 PE=1 SV=2 11 375 1.0E-80
sp|Q5R481|SEPT7_PONAB Septin-7 OS=Pongo abelii GN=SEPT7 PE=2 SV=2 11 375 1.0E-80
sp|O55131|SEPT7_MOUSE Septin-7 OS=Mus musculus GN=Sept7 PE=1 SV=1 11 375 2.0E-80
sp|Q9JJM9|SEPT5_RAT Septin-5 OS=Rattus norvegicus GN=Sept5 PE=1 SV=2 11 338 2.0E-80
sp|Q9WVC0|SEPT7_RAT Septin-7 OS=Rattus norvegicus GN=Sept7 PE=1 SV=1 11 375 2.0E-80
sp|Q6GLZ5|SEPT7_XENLA Septin-7 OS=Xenopus laevis GN=sept7 PE=2 SV=1 11 375 6.0E-80
sp|A1L0Y5|SEP2B_XENTR Septin-2B OS=Xenopus tropicalis GN=sept2-B PE=2 SV=1 11 338 9.0E-80
sp|Q07657|SHS1_YEAST Seventh homolog of septin 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SHS1 PE=1 SV=1 4 292 1.0E-79
sp|Q0VC68|SEPT5_BOVIN Septin-5 OS=Bos taurus GN=SEPT5 PE=2 SV=1 11 330 2.0E-79
sp|Q5BKN4|SEP2A_XENTR Septin-2A OS=Xenopus tropicalis GN=sept2-A PE=2 SV=1 11 338 3.0E-79
sp|Q9Z2Q6|SEPT5_MOUSE Septin-5 OS=Mus musculus GN=Sept5 PE=1 SV=2 11 330 3.0E-79
sp|Q63ZQ1|SEP2B_XENLA Septin-2B OS=Xenopus laevis GN=sept2-b PE=2 SV=1 11 338 1.0E-78
sp|Q5RA66|SEPT2_PONAB Septin-2 OS=Pongo abelii GN=SEPT2 PE=2 SV=1 11 330 1.0E-78
sp|Q91Y81|SEPT2_RAT Septin-2 OS=Rattus norvegicus GN=Sept2 PE=1 SV=1 11 330 1.0E-78
sp|Q5ZMH1|SEPT2_CHICK Septin-2 OS=Gallus gallus GN=SEPT2 PE=2 SV=1 11 338 1.0E-78
sp|Q15019|SEPT2_HUMAN Septin-2 OS=Homo sapiens GN=SEPT2 PE=1 SV=1 11 330 2.0E-78
sp|P40797|PNUT_DROME Protein peanut OS=Drosophila melanogaster GN=pnut PE=1 SV=2 11 355 2.0E-78
sp|Q2NKY7|SEPT2_BOVIN Septin-2 OS=Bos taurus GN=SEPT2 PE=2 SV=1 11 330 4.0E-78
sp|P42208|SEPT2_MOUSE Septin-2 OS=Mus musculus GN=Sept2 PE=1 SV=2 11 330 4.0E-78
sp|A5PJU9|SEPT1_BOVIN Septin-1 OS=Bos taurus GN=SEPT1 PE=2 SV=1 11 338 3.0E-77
sp|Q9DE33|SEP2A_XENLA Septin-2A OS=Xenopus laevis GN=sept2-a PE=1 SV=1 11 338 3.0E-77
sp|Q8WYJ6|SEPT1_HUMAN Septin-1 OS=Homo sapiens GN=SEPT1 PE=1 SV=2 11 330 1.0E-75
sp|Q5EB96|SEPT1_RAT Septin-1 OS=Rattus norvegicus GN=Sept1 PE=1 SV=1 11 330 2.0E-75
sp|P42209|SEPT1_MOUSE Septin-1 OS=Mus musculus GN=Sept1 PE=1 SV=2 11 330 2.0E-75
sp|A2BGU8|SEPT3_DANRE Neuronal-specific septin-3 OS=Danio rerio GN=sept3 PE=2 SV=1 10 292 2.0E-74
sp|Q6AXA6|SEP8A_XENLA Septin-8-A OS=Xenopus laevis GN=sept8-a PE=2 SV=1 2 364 4.0E-73
sp|A4FUM1|SEP8B_DANRE Septin-8-B OS=Danio rerio GN=sept8b PE=2 SV=1 2 354 5.0E-73
sp|Q6IRQ5|SEP8B_XENLA Septin-8-B OS=Xenopus laevis GN=sept8-b PE=2 SV=1 12 364 7.0E-73
sp|B1H120|SEPT8_XENTR Septin-8 OS=Xenopus tropicalis GN=sept8 PE=2 SV=1 2 364 2.0E-72
sp|P39826|CDC3_CANAX Cell division control protein 3 OS=Candida albicans GN=CDC3 PE=3 SV=1 11 355 2.0E-72
sp|Q08DM7|SEPT3_BOVIN Neuronal-specific septin-3 OS=Bos taurus GN=SEPT3 PE=2 SV=3 10 292 4.0E-72
sp|A6QQL3|SEP14_BOVIN Septin-14 OS=Bos taurus GN=SEPT14 PE=2 SV=1 12 363 4.0E-72
sp|Q9Z1S5|SEPT3_MOUSE Neuronal-specific septin-3 OS=Mus musculus GN=Sept3 PE=1 SV=2 10 292 5.0E-72
sp|Q9WU34|SEPT3_RAT Neuronal-specific septin-3 OS=Rattus norvegicus GN=Sept3 PE=1 SV=2 10 292 1.0E-71
sp|P54359|SEPT2_DROME Septin-2 OS=Drosophila melanogaster GN=Sep2 PE=2 SV=2 2 374 2.0E-71
sp|Q9UH03|SEPT3_HUMAN Neuronal-specific septin-3 OS=Homo sapiens GN=SEPT3 PE=1 SV=3 10 292 2.0E-71
sp|Q642H3|SEP8A_DANRE Septin-8-A OS=Danio rerio GN=sept8a PE=2 SV=2 2 366 2.0E-71
sp|Q6ZU15|SEP14_HUMAN Septin-14 OS=Homo sapiens GN=SEPT14 PE=1 SV=2 4 363 1.0E-70
sp|O36023|SPN1_SCHPO Septin homolog spn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spn1 PE=1 SV=2 2 374 2.0E-70
sp|B1MTN8|SEPT8_CALMO Septin-8 OS=Callicebus moloch GN=SEPT8 PE=3 SV=1 2 333 1.0E-69
sp|O60165|SPN7_SCHPO Septin homolog spn7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spn7 PE=1 SV=2 15 292 1.0E-69
sp|B2KIE9|SEPT8_RHIFE Septin-8 OS=Rhinolophus ferrumequinum GN=SEPT8 PE=3 SV=1 2 333 1.0E-69
sp|Q0VCP4|SEPT8_BOVIN Septin-8 OS=Bos taurus GN=SEPT8 PE=2 SV=3 2 333 2.0E-69
sp|Q8CHH9|SEPT8_MOUSE Septin-8 OS=Mus musculus GN=Sept8 PE=1 SV=4 2 333 2.0E-69
sp|Q2KJB1|SEP10_BOVIN Septin-10 OS=Bos taurus GN=SEPT10 PE=2 SV=1 2 363 2.0E-69
sp|B0KWP7|SEPT8_CALJA Septin-8 OS=Callithrix jacchus GN=SEPT8 PE=3 SV=1 2 333 4.0E-69
sp|Q5REG8|SEP10_PONAB Septin-10 OS=Pongo abelii GN=SEPT10 PE=2 SV=1 2 363 4.0E-69
sp|B5FW69|SEPT8_OTOGA Septin-8 OS=Otolemur garnettii GN=SEPT8 PE=3 SV=1 2 333 7.0E-69
sp|Q9P0V9|SEP10_HUMAN Septin-10 OS=Homo sapiens GN=SEPT10 PE=1 SV=2 2 363 9.0E-69
sp|B0BNF1|SEPT8_RAT Septin-8 OS=Rattus norvegicus GN=Sept8 PE=1 SV=1 2 333 1.0E-68
sp|Q92599|SEPT8_HUMAN Septin-8 OS=Homo sapiens GN=SEPT8 PE=1 SV=4 2 333 2.0E-68
sp|Q9DA97|SEP14_MOUSE Septin-14 OS=Mus musculus GN=Sept14 PE=1 SV=3 4 340 3.0E-68
sp|Q5PQK1|SEP10_RAT Septin-10 OS=Rattus norvegicus GN=Sept10 PE=1 SV=1 2 363 1.0E-67
sp|A2VE99|SEP11_BOVIN Septin-11 OS=Bos taurus GN=SEPT11 PE=2 SV=1 2 291 2.0E-67
sp|Q9NVA2|SEP11_HUMAN Septin-11 OS=Homo sapiens GN=SEPT11 PE=1 SV=3 2 291 3.0E-67
sp|Q5R8U3|SEP11_PONAB Septin-11 OS=Pongo abelii GN=SEPT11 PE=2 SV=3 2 291 3.0E-67
sp|B3GNI6|SEP11_RAT Septin-11 OS=Rattus norvegicus GN=Sept11 PE=1 SV=1 2 291 4.0E-67
sp|Q8C1B7|SEP11_MOUSE Septin-11 OS=Mus musculus GN=Sept11 PE=1 SV=4 2 291 4.0E-67
sp|Q8C650|SEP10_MOUSE Septin-10 OS=Mus musculus GN=Sept10 PE=1 SV=1 2 363 1.0E-66
sp|Q4R555|SEP11_MACFA Septin-11 OS=Macaca fascicularis GN=SEPT11 PE=2 SV=3 2 291 4.0E-66
sp|Q09116|SPN2_SCHPO Septin homolog spn2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spn2 PE=1 SV=2 11 292 8.0E-66
sp|Q4V8G5|SEP12_RAT Septin-12 OS=Rattus norvegicus GN=Sept12 PE=1 SV=2 10 294 2.0E-65
sp|Q80UG5|SEPT9_MOUSE Septin-9 OS=Mus musculus GN=Sept9 PE=1 SV=1 10 303 6.0E-65
sp|Q9UHD8|SEPT9_HUMAN Septin-9 OS=Homo sapiens GN=SEPT9 PE=1 SV=2 10 292 7.0E-65
sp|Q14141|SEPT6_HUMAN Septin-6 OS=Homo sapiens GN=SEPT6 PE=1 SV=4 2 339 3.0E-64
sp|Q8IYM1|SEP12_HUMAN Septin-12 OS=Homo sapiens GN=SEPT12 PE=1 SV=1 12 294 7.0E-64
sp|Q9QZR6|SEPT9_RAT Septin-9 OS=Rattus norvegicus GN=Sept9 PE=1 SV=1 10 303 9.0E-64
sp|P48009|SPN4_SCHPO Septin homolog spn4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spn4 PE=1 SV=1 9 364 3.0E-63
sp|Q9R1T4|SEPT6_MOUSE Septin-6 OS=Mus musculus GN=Sept6 PE=1 SV=4 2 339 4.0E-63
sp|A5D7Q3|SEP12_BOVIN Septin-12 OS=Bos taurus GN=SEPT12 PE=2 SV=1 12 294 5.0E-63
sp|Q3SZN0|SEPT6_BOVIN Septin-6 OS=Bos taurus GN=SEPT6 PE=2 SV=1 2 339 3.0E-62
sp|P32468|CDC12_YEAST Cell division control protein 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC12 PE=1 SV=1 17 364 7.0E-61
sp|P25342|CDC10_YEAST Cell division control protein 10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC10 PE=1 SV=1 14 307 1.0E-59
sp|P39827|CDC10_CANAL Cell division control protein 10 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDC10 PE=2 SV=1 14 300 2.0E-59
sp|Q09883|SPN6_SCHPO Septin homolog spn6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spn6 PE=1 SV=1 15 368 3.0E-59
sp|P32457|CDC3_YEAST Cell division control protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC3 PE=1 SV=3 4 374 9.0E-58
sp|Q04921|SPR28_YEAST Sporulation-regulated protein 28 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPR28 PE=1 SV=1 8 292 2.0E-57
sp|Q8STS8|CDC11_ENCCU Cell division control protein 11 OS=Encephalitozoon cuniculi (strain GB-M1) GN=CDC11 PE=1 SV=2 7 295 7.0E-54
sp|P48010|SPN5_SCHPO Septin homolog spn5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spn5 PE=1 SV=2 14 365 2.0E-53
sp|P41901|SPR3_YEAST Sporulation-regulated protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPR3 PE=1 SV=1 13 351 1.0E-48
sp|Q8SQR3|CDC10_ENCCU Cell division control protein 10 OS=Encephalitozoon cuniculi (strain GB-M1) GN=CDC10 PE=1 SV=2 10 348 7.0E-33
sp|Q8SSI8|CDC3_ENCCU Cell division control protein 3 OS=Encephalitozoon cuniculi (strain GB-M1) GN=CDC3 PE=1 SV=1 8 365 9.0E-28
[Show less]

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0032553 ribonucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0000166 nucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0019001 guanyl nucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032561 guanyl ribonucleotide binding No
GO:0043168 anion binding No
GO:0036094 small molecule binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0097367 carbohydrate derivative binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|3
MSSPAKMIRRKKNVKKGIQFCLMVCGASGTGRTTFVNTLCGKDVLQHKESDDAQEAHVEDGVKIKPVTVELELDE
EGTRISLTIVDTPGFGDQVDNEASFAEIVGYLERQYDDILAEESRIKRNPRFRDNRVHVMLYFITPTGHGLRELD
IELMKRLAPRVNVIPVIGRADSLTPPELAESKKLVMEDIEHYRIPVYNFPYDIEEDDEDTVEENAELRGLMPFAI
VGSEEVMEIGGRRARARQYPWGVVEVDNPRHSDFLAIRSALLHSHLADLKEITHDFLYENYRTEKLSKSVDGASG
NVDSSMNPEDLASQSVRLKEEQLRREEEKLREIEMKVQREINEKRQELLARESQLREIEARMQREASQAPAAAEA
NGEVAE*
Coding >OphauB2|3
ATGTCTTCTCCTGCCAAAATGATTCGCCGGAAGAAGAATGTCAAAAAGGGTATTCAATTCTGCTTGATGGTCTGT
GGTGCCTCTGGAACTGGCCGAACCACATTCGTCAACACTCTGTGCGGCAAGGATGTCCTCCAACACAAGGAGTCT
GACGATGCCCAAGAGGCCCATGTCGAGGACGGTGTCAAGATCAAGCCCGTCACCGTTGAGCTTGAACTTGACGAG
GAGGGAACTCGCATTTCCCTAACCATTGTCGACACGCCGGGTTTCGGTGACCAGGTGGATAACGAAGCTAGCTTT
GCGGAGATTGTCGGATACCTCGAGAGACAATACGATGACATCCTGGCCGAAGAGTCTCGCATCAAGCGTAACCCC
CGTTTCAGGGATAATCGCGTTCACGTCATGCTTTATTTCATCACCCCTACTGGCCATGGTCTGCGAGAGCTCGAC
ATTGAATTGATGAAGCGCCTCGCACCTCGTGTCAATGTCATTCCTGTCATTGGTCGTGCTGATTCTCTCACACCG
CCAGAGCTCGCCGAGTCGAAGAAGTTGGTCATGGAAGACATTGAGCACTATCGGATCCCCGTCTACAACTTCCCC
TACGATATTGAAGAAGATGACGAGGATACTGTTGAGGAAAACGCCGAACTCAGGGGACTTATGCCCTTTGCTATT
GTGGGCTCGGAGGAAGTCATGGAAATTGGCGGTCGCAGGGCTCGTGCCCGACAGTATCCTTGGGGTGTTGTCGAG
GTGGACAACCCGCGCCACTCTGATTTCTTGGCAATTCGTTCTGCTCTCTTGCACAGCCACTTGGCCGATCTCAAG
GAAATCACTCATGACTTCCTCTATGAGAACTACCGTACCGAGAAGCTGTCTAAGAGTGTGGACGGTGCCTCTGGA
AACGTTGATAGCTCCATGAACCCCGAGGACCTGGCTTCTCAATCTGTCCGACTCAAGGAAGAACAGCTCCGCCGC
GAGGAAGAGAAACTGCGCGAAATCGAAATGAAGGTACAGCGCGAGATTAATGAGAAGCGACAGGAACTCCTAGCT
CGCGAATCACAACTGCGAGAAATAGAGGCGCGCATGCAGCGCGAGGCCTCGCAGGCGCCAGCTGCTGCCGAGGCG
AATGGCGAGGTGGCAGAGTAA
Transcript >OphauB2|3
ATGTCTTCTCCTGCCAAAATGATTCGCCGGAAGAAGAATGTCAAAAAGGGTATTCAATTCTGCTTGATGGTCTGT
GGTGCCTCTGGAACTGGCCGAACCACATTCGTCAACACTCTGTGCGGCAAGGATGTCCTCCAACACAAGGAGTCT
GACGATGCCCAAGAGGCCCATGTCGAGGACGGTGTCAAGATCAAGCCCGTCACCGTTGAGCTTGAACTTGACGAG
GAGGGAACTCGCATTTCCCTAACCATTGTCGACACGCCGGGTTTCGGTGACCAGGTGGATAACGAAGCTAGCTTT
GCGGAGATTGTCGGATACCTCGAGAGACAATACGATGACATCCTGGCCGAAGAGTCTCGCATCAAGCGTAACCCC
CGTTTCAGGGATAATCGCGTTCACGTCATGCTTTATTTCATCACCCCTACTGGCCATGGTCTGCGAGAGCTCGAC
ATTGAATTGATGAAGCGCCTCGCACCTCGTGTCAATGTCATTCCTGTCATTGGTCGTGCTGATTCTCTCACACCG
CCAGAGCTCGCCGAGTCGAAGAAGTTGGTCATGGAAGACATTGAGCACTATCGGATCCCCGTCTACAACTTCCCC
TACGATATTGAAGAAGATGACGAGGATACTGTTGAGGAAAACGCCGAACTCAGGGGACTTATGCCCTTTGCTATT
GTGGGCTCGGAGGAAGTCATGGAAATTGGCGGTCGCAGGGCTCGTGCCCGACAGTATCCTTGGGGTGTTGTCGAG
GTGGACAACCCGCGCCACTCTGATTTCTTGGCAATTCGTTCTGCTCTCTTGCACAGCCACTTGGCCGATCTCAAG
GAAATCACTCATGACTTCCTCTATGAGAACTACCGTACCGAGAAGCTGTCTAAGAGTGTGGACGGTGCCTCTGGA
AACGTTGATAGCTCCATGAACCCCGAGGACCTGGCTTCTCAATCTGTCCGACTCAAGGAAGAACAGCTCCGCCGC
GAGGAAGAGAAACTGCGCGAAATCGAAATGAAGGTACAGCGCGAGATTAATGAGAAGCGACAGGAACTCCTAGCT
CGCGAATCACAACTGCGAGAAATAGAGGCGCGCATGCAGCGCGAGGCCTCGCAGGCGCCAGCTGCTGCCGAGGCG
AATGGCGAGGTGGCAGAGTAA
Gene >OphauB2|3
ATGTCTTCTCCTGCCGTATGTCCTGTCCGCTCATTTGCTGCCTCTCTCGCTACCTTAATGTCTCTGCACTTGAGC
TGCATATTTTTGCCTCGACTCAGCCTTGCTCAATCACCTTTGTCGATTGCTATTTGAAGCTTGCTGACAGGTTTT
GTCGTGTCTAGAAAATGATTCGCCGGAAGAAGAATGTCAAAAAGGGTATTCAATTCTGCTTGATGGTCTGTGGTG
CCTCTGGAACTGGTAAGAATGCCCCTGCTGCTGCTGCTCTCGTGGCGCAAGTCCCTTCAACACCTTGCTGATACT
CAAATCCTCTGCAGGCCGAACCACATTCGTCAACACTCTGTGCGGCAAGGATGTCCTCCAACACAAGGAGTCTGA
CGATGCCCAAGAGGCCCATGTCGAGGACGGTGTCAAGATCAAGCCCGTCACCGTTGGTGCGTTTGGCCCTGCCAA
TTTTTCTGGTGTGTGCTAATTGAGTCAGAGCTTGAACTTGACGAGGAGGGAACTCGCATTTCCCTAACCATTGTC
GACACGCCGGGTTTCGGTGACCAGGTGGATAACGAAGCTAGGTACACTGTCTGCGTTGATGTCTCGACGTGATGC
CATCTAACGGCTTAAAGCTTTGCGGAGATTGTCGGATACCTCGAGAGACAATACGATGACATCCTGGCCGAAGAG
TCTCGCATCAAGCGTAACCCCCGTTTCAGGGATAATCGCGTTCACGTCATGCTTTATTTCATCACCCCTACTGGC
CATGGGTAAGTGCCATTGGAGTCATTGACTGTCTGCCACTAACATGCTACAGTCTGCGAGAGCTCGACATTGAAT
TGATGAAGCGCCTCGCACCTCGTGTCAATGTCATTCCTGTCATTGGTCGTGCTGATTCTCTCACACCGCCAGAGC
TCGCCGAGTCGAAGAAGTTGGTCATGGAAGACATTGAGCACTATCGGATCCCCGTCTACAACTTCCCCTACGATA
TTGAAGAAGATGACGAGGATACTGTTGAGGAAAACGCCGAACTCAGGGGACTTATGCCCTTTGCTATTGTGGGCT
CGGAGGAAGTCATGGAAATTGGCGGTCGCAGGGCTCGTGCCCGACAGTATCCTTGGGGTGTTGTCGAGGTGGACA
ACCCGCGCCACTCTGATTTCTTGGCAATTCGTTCTGCTCTCTTGCACAGCCACTTGGCCGATCTCAAGGAAATCA
CTCATGACTTCCTCTATGAGAACTACCGTACCGAGAAGCTGTCTAAGAGTGTGGACGGTGCCTCTGGAAAGTTGG
TTGCCCCCTTTTCTCCATTTCTCGGGCTTGAGATGCTAACGATATATGTAGCGTTGATAGCTCCATGAACCCCGA
GGACCTGGCTTCTCAATCTGTCCGACTCAAGGAAGAACAGCTCCGCCGCGAGGAAGAGAAACTGCGCGAAATCGA
AATGAAGGTACAGCGCGAGATTAATGAGAAGCGACAGGAACTCCTAGCTCGCGAATCACAACTGCGAGAAATAGA
GGCGCGCATGCAGCGCGAGGCCTCGCAGGCGCCAGCTGCTGCCGAGGCGAATGGCGAGGTGGCAGAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail