Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2985
Gene name
LocationContig_2:223333..223807
Strand+
Gene length (bp)474
Transcript length (bp)474
Coding sequence length (bp)474
Protein length (aa) 158

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12716 Apq12 Nuclear pore assembly and biogenesis 1.2E-06 56 106

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

Domain # Start End Length
1 57 79 22
2 86 108 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2985
MDLVPTILRMAVELLPISAAVQLFSVASEIQNHARDTVYMLSETEGDYGGNSSGSAVPLLAGLTTLAIAFLVVVW
TVRLIIFWTRLALRVALWTALLTGCALIWTRGVGPCLRDAVIVAAKALGFLMVVKDVCIEAYIRYNERESLAQTG
ATGNWVS*
Coding >OphauB2|2985
ATGGACCTGGTTCCCACCATCTTGCGCATGGCTGTCGAGCTTCTCCCCATTTCAGCAGCGGTGCAGCTGTTCAGC
GTCGCATCAGAGATTCAAAATCACGCACGCGACACCGTCTACATGTTGTCAGAGACTGAAGGCGACTATGGTGGC
AACAGCAGTGGCTCGGCTGTGCCGCTGCTTGCTGGACTCACAACCCTGGCCATTGCCTTCTTGGTCGTGGTTTGG
ACGGTGCGCCTCATTATCTTTTGGACGCGTCTTGCTTTGCGCGTCGCGCTGTGGACTGCTCTATTGACGGGCTGC
GCTCTCATCTGGACACGTGGTGTGGGACCTTGTCTGCGCGACGCTGTTATTGTGGCGGCAAAAGCCCTGGGCTTC
TTAATGGTGGTCAAGGATGTCTGCATCGAGGCCTACATTCGCTACAACGAACGGGAGAGTTTGGCACAAACAGGC
GCCACAGGCAACTGGGTCTCGTAA
Transcript >OphauB2|2985
ATGGACCTGGTTCCCACCATCTTGCGCATGGCTGTCGAGCTTCTCCCCATTTCAGCAGCGGTGCAGCTGTTCAGC
GTCGCATCAGAGATTCAAAATCACGCACGCGACACCGTCTACATGTTGTCAGAGACTGAAGGCGACTATGGTGGC
AACAGCAGTGGCTCGGCTGTGCCGCTGCTTGCTGGACTCACAACCCTGGCCATTGCCTTCTTGGTCGTGGTTTGG
ACGGTGCGCCTCATTATCTTTTGGACGCGTCTTGCTTTGCGCGTCGCGCTGTGGACTGCTCTATTGACGGGCTGC
GCTCTCATCTGGACACGTGGTGTGGGACCTTGTCTGCGCGACGCTGTTATTGTGGCGGCAAAAGCCCTGGGCTTC
TTAATGGTGGTCAAGGATGTCTGCATCGAGGCCTACATTCGCTACAACGAACGGGAGAGTTTGGCACAAACAGGC
GCCACAGGCAACTGGGTCTCGTAA
Gene >OphauB2|2985
ATGGACCTGGTTCCCACCATCTTGCGCATGGCTGTCGAGCTTCTCCCCATTTCAGCAGCGGTGCAGCTGTTCAGC
GTCGCATCAGAGATTCAAAATCACGCACGCGACACCGTCTACATGTTGTCAGAGACTGAAGGCGACTATGGTGGC
AACAGCAGTGGCTCGGCTGTGCCGCTGCTTGCTGGACTCACAACCCTGGCCATTGCCTTCTTGGTCGTGGTTTGG
ACGGTGCGCCTCATTATCTTTTGGACGCGTCTTGCTTTGCGCGTCGCGCTGTGGACTGCTCTATTGACGGGCTGC
GCTCTCATCTGGACACGTGGTGTGGGACCTTGTCTGCGCGACGCTGTTATTGTGGCGGCAAAAGCCCTGGGCTTC
TTAATGGTGGTCAAGGATGTCTGCATCGAGGCCTACATTCGCTACAACGAACGGGAGAGTTTGGCACAAACAGGC
GCCACAGGCAACTGGGTCTCGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail