Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2982
Gene name
LocationContig_2:218224..218527
Strand-
Gene length (bp)303
Transcript length (bp)303
Coding sequence length (bp)303
Protein length (aa) 101

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01494 FAD_binding_3 FAD binding domain 1.4E-12 6 83
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 3.1E-07 9 44

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9S158|MHPA_COMTE 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Comamonas testosteroni GN=mhpA PE=3 SV=1 7 88 2.0E-07

GO

GO Term Description Terminal node
GO:0071949 FAD binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0036094 small molecule binding No
GO:0043168 anion binding No
GO:0050660 flavin adenine dinucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.5

Transmembrane Domains

Domain # Start End Length
1 5 23 18

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2982
MMKQFTVAVVGGGIAGLALANLLEKLGIHYLVFEAYPRITSQSGTSIGWHPHGLRILDSLGLCDQVMAAAAPVST
MTFRTSNGTLLYSHRILEHIEQRCC*
Coding >OphauB2|2982
ATGATGAAGCAATTCACTGTTGCCGTTGTTGGCGGCGGCATTGCTGGTCTCGCTCTGGCCAACCTTTTGGAAAAG
CTCGGCATCCATTACCTTGTTTTTGAAGCATACCCTAGAATTACTTCGCAAAGCGGCACGAGTATTGGCTGGCAT
CCTCATGGGCTTCGGATTCTCGACAGCTTGGGGCTGTGTGATCAAGTCATGGCGGCGGCGGCACCAGTTTCCACC
ATGACGTTTCGCACAAGCAACGGGACTCTGTTGTATTCGCATCGCATCTTGGAGCACATTGAACAAAGGTGTTGT
TGA
Transcript >OphauB2|2982
ATGATGAAGCAATTCACTGTTGCCGTTGTTGGCGGCGGCATTGCTGGTCTCGCTCTGGCCAACCTTTTGGAAAAG
CTCGGCATCCATTACCTTGTTTTTGAAGCATACCCTAGAATTACTTCGCAAAGCGGCACGAGTATTGGCTGGCAT
CCTCATGGGCTTCGGATTCTCGACAGCTTGGGGCTGTGTGATCAAGTCATGGCGGCGGCGGCACCAGTTTCCACC
ATGACGTTTCGCACAAGCAACGGGACTCTGTTGTATTCGCATCGCATCTTGGAGCACATTGAACAAAGGTGTTGT
TGA
Gene >OphauB2|2982
ATGATGAAGCAATTCACTGTTGCCGTTGTTGGCGGCGGCATTGCTGGTCTCGCTCTGGCCAACCTTTTGGAAAAG
CTCGGCATCCATTACCTTGTTTTTGAAGCATACCCTAGAATTACTTCGCAAAGCGGCACGAGTATTGGCTGGCAT
CCTCATGGGCTTCGGATTCTCGACAGCTTGGGGCTGTGTGATCAAGTCATGGCGGCGGCGGCACCAGTTTCCACC
ATGACGTTTCGCACAAGCAACGGGACTCTGTTGTATTCGCATCGCATCTTGGAGCACATTGAACAAAGGTGTTGT
TGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail