Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2982
Gene name
LocationContig_2:218224..218527
Strand-
Gene length (bp)303
Transcript length (bp)303
Coding sequence length (bp)303
Protein length (aa) 101

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01494 FAD_binding_3 FAD binding domain 1.4E-12 6 83
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 3.1E-07 9 44

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9S158|MHPA_COMTE 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Comamonas testosteroni GN=mhpA PE=3 SV=1 7 88 2.0E-07

GO

GO Term Description Terminal node
GO:0071949 FAD binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0036094 small molecule binding No
GO:0043168 anion binding No
GO:0050660 flavin adenine dinucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 5 23 18

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup63
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6183
Ophiocordyceps australis 1348a (Ghana) OphauG2|6246
Ophiocordyceps australis map64 (Brazil) OphauB2|1391
Ophiocordyceps australis map64 (Brazil) OphauB2|2981
Ophiocordyceps australis map64 (Brazil) OphauB2|2982 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|4757
Ophiocordyceps camponoti-floridani Ophcf2|02169
Ophiocordyceps camponoti-floridani Ophcf2|05915
Ophiocordyceps camponoti-floridani Ophcf2|04805
Ophiocordyceps camponoti-rufipedis Ophun1|6198
Ophiocordyceps camponoti-rufipedis Ophun1|5787
Ophiocordyceps kimflemingae Ophio5|1107
Ophiocordyceps kimflemingae Ophio5|2267
Ophiocordyceps kimflemingae Ophio5|2268
Ophiocordyceps kimflemingae Ophio5|3035
Ophiocordyceps subramaniannii Hirsu2|5140
Ophiocordyceps subramaniannii Hirsu2|4439

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2982
MMKQFTVAVVGGGIAGLALANLLEKLGIHYLVFEAYPRITSQSGTSIGWHPHGLRILDSLGLCDQVMAAAAPVST
MTFRTSNGTLLYSHRILEHIEQRCC*
Coding >OphauB2|2982
ATGATGAAGCAATTCACTGTTGCCGTTGTTGGCGGCGGCATTGCTGGTCTCGCTCTGGCCAACCTTTTGGAAAAG
CTCGGCATCCATTACCTTGTTTTTGAAGCATACCCTAGAATTACTTCGCAAAGCGGCACGAGTATTGGCTGGCAT
CCTCATGGGCTTCGGATTCTCGACAGCTTGGGGCTGTGTGATCAAGTCATGGCGGCGGCGGCACCAGTTTCCACC
ATGACGTTTCGCACAAGCAACGGGACTCTGTTGTATTCGCATCGCATCTTGGAGCACATTGAACAAAGGTGTTGT
TGA
Transcript >OphauB2|2982
ATGATGAAGCAATTCACTGTTGCCGTTGTTGGCGGCGGCATTGCTGGTCTCGCTCTGGCCAACCTTTTGGAAAAG
CTCGGCATCCATTACCTTGTTTTTGAAGCATACCCTAGAATTACTTCGCAAAGCGGCACGAGTATTGGCTGGCAT
CCTCATGGGCTTCGGATTCTCGACAGCTTGGGGCTGTGTGATCAAGTCATGGCGGCGGCGGCACCAGTTTCCACC
ATGACGTTTCGCACAAGCAACGGGACTCTGTTGTATTCGCATCGCATCTTGGAGCACATTGAACAAAGGTGTTGT
TGA
Gene >OphauB2|2982
ATGATGAAGCAATTCACTGTTGCCGTTGTTGGCGGCGGCATTGCTGGTCTCGCTCTGGCCAACCTTTTGGAAAAG
CTCGGCATCCATTACCTTGTTTTTGAAGCATACCCTAGAATTACTTCGCAAAGCGGCACGAGTATTGGCTGGCAT
CCTCATGGGCTTCGGATTCTCGACAGCTTGGGGCTGTGTGATCAAGTCATGGCGGCGGCGGCACCAGTTTCCACC
ATGACGTTTCGCACAAGCAACGGGACTCTGTTGTATTCGCATCGCATCTTGGAGCACATTGAACAAAGGTGTTGT
TGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail