Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2981
Gene name
LocationContig_2:215651..217707
Strand-
Gene length (bp)2056
Transcript length (bp)1926
Coding sequence length (bp)1926
Protein length (aa) 642

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01494 FAD_binding_3 FAD binding domain 1.1E-11 35 237

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O81360|ABA2_PRUAR Zeaxanthin epoxidase, chloroplastic OS=Prunus armeniaca PE=2 SV=1 20 312 2.0E-08
sp|C3VEQ2|ZEP_ONCHC Zeaxanthin epoxidase, chloroplastic OS=Oncidium hybrid cultivar GN=ZEP PE=2 SV=1 16 261 1.0E-07

GO

GO Term Description Terminal node
GO:0071949 FAD binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0036094 small molecule binding No
GO:0043168 anion binding No
GO:0050660 flavin adenine dinucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 343 362 19
2 444 466 22
3 492 514 22
4 521 543 22
5 563 585 22
6 616 638 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2981
MERDKAIEILYNNLRNKNQVLTAQRITKVEHLADKVRLHAASGDTFDAHVVIGADGTHSVIRRDMCDMMEKWLPA
KQTRAPITIKTEYGCIFGMSRPTGDLRATHAHLVHKKHVSITCLGGPGDRLYWFLFFKLPRAHLGHDYPQCSKAD
ERALVAQEAETRLTPSVCFKQLHDNLILCRTTPLPQYLVAEWHYRRIMLLGDSAHKLHPLTGQGGNLALEAAAAL
ADCLWNALKDGHGSPSAQQIDSAFSHAQQLCQQRAARLVESSFQEYRMASWANKAYEIMDCYLVPHLDTPMLVDR
ISSYIVGGYQSQCIVGKSNKAPPTHCIPYYNELAHKPALHSSQLLYIVAGYLVLLSMAVHVANRLPRVCELAAAL
PHQQHVGSLDYAPLLDACSSSLYAFFSAAGWNPTYRLLIFYSFASQSLVFATWTMESCRPRSSIKPIALVLLVEF
LAHFSALRIMVPILYLIDNMTTVLSSQWWPTATFVTPAKAKRVLPACVIGLFLPLLLMLNPLSPSYLRHALTVMY
MACPVWLYLCKTCPLHTIPEQTYSQLAAPQSVAHIRQLYTTLAMMTGLVYMGTVASILASVDAGSRLQNVLEVLW
FPSCRTADLYQQAHMLLLWRLYTSAVPLLLWNFYSSLAASR*
Coding >OphauB2|2981
ATGGAGCGCGACAAGGCCATAGAAATCCTATACAACAACCTCAGAAACAAGAATCAAGTCCTGACTGCACAGCGC
ATCACAAAGGTCGAGCACCTGGCCGACAAGGTTCGCCTGCATGCTGCCAGCGGCGACACCTTTGATGCCCATGTA
GTTATTGGGGCCGATGGAACTCACAGCGTGATACGACGCGACATGTGCGACATGATGGAGAAATGGCTGCCCGCC
AAGCAGACTCGGGCTCCAATAACCATCAAAACAGAGTATGGCTGCATTTTCGGCATGTCCCGGCCTACTGGCGAC
CTCAGGGCAACTCATGCCCACCTGGTGCACAAGAAGCATGTCAGCATCACCTGCTTGGGCGGCCCAGGCGATAGA
CTGTATTGGTTTCTCTTCTTCAAACTCCCTCGAGCTCACTTGGGACACGACTATCCACAGTGCTCCAAGGCAGAT
GAAAGAGCACTCGTTGCACAGGAAGCCGAAACCCGCCTGACGCCCAGTGTCTGCTTCAAGCAGCTCCATGACAAC
CTCATCTTGTGCAGAACGACGCCCTTGCCGCAGTACCTTGTTGCAGAGTGGCATTACCGACGCATCATGCTGCTT
GGCGACTCGGCACACAAGCTCCATCCCCTGACTGGCCAAGGTGGCAACCTGGCTCTCGAGGCTGCGGCAGCCTTG
GCAGACTGCCTCTGGAATGCCCTCAAAGACGGCCATGGCAGCCCATCAGCCCAGCAAATCGACTCGGCCTTTTCT
CACGCACAGCAGCTGTGCCAACAACGAGCGGCCCGTCTCGTCGAGAGCAGCTTCCAGGAATACCGCATGGCATCG
TGGGCCAACAAGGCCTATGAAATCATGGACTGCTACCTCGTGCCGCACCTTGATACGCCCATGCTCGTCGACAGA
ATCAGCTCCTATATTGTTGGCGGCTACCAGTCGCAATGCATAGTCGGCAAGAGCAACAAGGCACCGCCCACGCAC
TGCATCCCCTATTACAACGAGCTGGCGCATAAGCCAGCATTGCATAGCTCCCAGCTCCTATACATCGTGGCCGGC
TACCTCGTGCTGCTCTCCATGGCCGTGCATGTGGCAAATCGCTTGCCCCGCGTATGCGAGCTTGCTGCTGCTCTT
CCTCACCAGCAACATGTTGGCAGCCTCGACTATGCTCCCTTGCTTGATGCCTGCTCCTCCTCTCTCTACGCCTTC
TTCTCGGCCGCTGGGTGGAATCCTACTTACAGGCTGCTCATATTCTACTCCTTTGCCTCTCAGTCGCTAGTCTTT
GCCACATGGACCATGGAGTCGTGCCGGCCTCGGAGCAGCATCAAGCCCATTGCCCTTGTTCTCCTTGTAGAGTTC
CTCGCCCATTTCTCCGCCCTCAGAATCATGGTGCCCATCTTGTACTTGATTGACAACATGACGACGGTCCTTTCC
AGCCAGTGGTGGCCCACAGCAACATTTGTGACTCCGGCCAAGGCCAAGAGAGTACTGCCTGCCTGCGTCATTGGC
CTATTTCTTCCGCTATTGCTCATGCTCAACCCTTTGTCTCCAAGCTACCTACGTCACGCTCTGACAGTCATGTAC
ATGGCTTGTCCCGTCTGGCTATATCTATGCAAGACTTGTCCTTTGCATACCATTCCCGAGCAAACTTATAGCCAA
TTGGCAGCGCCCCAATCCGTTGCCCATATTCGCCAACTCTACACCACGCTTGCCATGATGACGGGCCTGGTATAC
ATGGGCACCGTCGCCTCCATCCTGGCATCAGTCGATGCTGGCTCTCGCCTTCAAAACGTCCTAGAGGTGCTTTGG
TTCCCATCTTGCCGCACCGCCGACCTCTATCAGCAAGCGCACATGCTGCTGCTTTGGCGCTTGTACACCTCGGCT
GTTCCTCTCCTGCTATGGAACTTTTACAGCTCGCTAGCAGCGAGTCGATAA
Transcript >OphauB2|2981
ATGGAGCGCGACAAGGCCATAGAAATCCTATACAACAACCTCAGAAACAAGAATCAAGTCCTGACTGCACAGCGC
ATCACAAAGGTCGAGCACCTGGCCGACAAGGTTCGCCTGCATGCTGCCAGCGGCGACACCTTTGATGCCCATGTA
GTTATTGGGGCCGATGGAACTCACAGCGTGATACGACGCGACATGTGCGACATGATGGAGAAATGGCTGCCCGCC
AAGCAGACTCGGGCTCCAATAACCATCAAAACAGAGTATGGCTGCATTTTCGGCATGTCCCGGCCTACTGGCGAC
CTCAGGGCAACTCATGCCCACCTGGTGCACAAGAAGCATGTCAGCATCACCTGCTTGGGCGGCCCAGGCGATAGA
CTGTATTGGTTTCTCTTCTTCAAACTCCCTCGAGCTCACTTGGGACACGACTATCCACAGTGCTCCAAGGCAGAT
GAAAGAGCACTCGTTGCACAGGAAGCCGAAACCCGCCTGACGCCCAGTGTCTGCTTCAAGCAGCTCCATGACAAC
CTCATCTTGTGCAGAACGACGCCCTTGCCGCAGTACCTTGTTGCAGAGTGGCATTACCGACGCATCATGCTGCTT
GGCGACTCGGCACACAAGCTCCATCCCCTGACTGGCCAAGGTGGCAACCTGGCTCTCGAGGCTGCGGCAGCCTTG
GCAGACTGCCTCTGGAATGCCCTCAAAGACGGCCATGGCAGCCCATCAGCCCAGCAAATCGACTCGGCCTTTTCT
CACGCACAGCAGCTGTGCCAACAACGAGCGGCCCGTCTCGTCGAGAGCAGCTTCCAGGAATACCGCATGGCATCG
TGGGCCAACAAGGCCTATGAAATCATGGACTGCTACCTCGTGCCGCACCTTGATACGCCCATGCTCGTCGACAGA
ATCAGCTCCTATATTGTTGGCGGCTACCAGTCGCAATGCATAGTCGGCAAGAGCAACAAGGCACCGCCCACGCAC
TGCATCCCCTATTACAACGAGCTGGCGCATAAGCCAGCATTGCATAGCTCCCAGCTCCTATACATCGTGGCCGGC
TACCTCGTGCTGCTCTCCATGGCCGTGCATGTGGCAAATCGCTTGCCCCGCGTATGCGAGCTTGCTGCTGCTCTT
CCTCACCAGCAACATGTTGGCAGCCTCGACTATGCTCCCTTGCTTGATGCCTGCTCCTCCTCTCTCTACGCCTTC
TTCTCGGCCGCTGGGTGGAATCCTACTTACAGGCTGCTCATATTCTACTCCTTTGCCTCTCAGTCGCTAGTCTTT
GCCACATGGACCATGGAGTCGTGCCGGCCTCGGAGCAGCATCAAGCCCATTGCCCTTGTTCTCCTTGTAGAGTTC
CTCGCCCATTTCTCCGCCCTCAGAATCATGGTGCCCATCTTGTACTTGATTGACAACATGACGACGGTCCTTTCC
AGCCAGTGGTGGCCCACAGCAACATTTGTGACTCCGGCCAAGGCCAAGAGAGTACTGCCTGCCTGCGTCATTGGC
CTATTTCTTCCGCTATTGCTCATGCTCAACCCTTTGTCTCCAAGCTACCTACGTCACGCTCTGACAGTCATGTAC
ATGGCTTGTCCCGTCTGGCTATATCTATGCAAGACTTGTCCTTTGCATACCATTCCCGAGCAAACTTATAGCCAA
TTGGCAGCGCCCCAATCCGTTGCCCATATTCGCCAACTCTACACCACGCTTGCCATGATGACGGGCCTGGTATAC
ATGGGCACCGTCGCCTCCATCCTGGCATCAGTCGATGCTGGCTCTCGCCTTCAAAACGTCCTAGAGGTGCTTTGG
TTCCCATCTTGCCGCACCGCCGACCTCTATCAGCAAGCGCACATGCTGCTGCTTTGGCGCTTGTACACCTCGGCT
GTTCCTCTCCTGCTATGGAACTTTTACAGCTCGCTAGCAGCGAGTCGATAA
Gene >OphauB2|2981
ATGGAGCGCGACAAGGCCATAGAAATCCTATACAACAACCTCAGAAACAAGAATCAAGTCCTGACTGCACAGCGC
ATCACAAAGGTCGAGCACCTGGCCGACAAGGTTCGCCTGCATGCTGCCAGCGGCGACACCTTTGATGCCCATGTA
GTTATTGGGGCCGATGGAACTCACAGCGTGATACGACGCGACATGTGCGACATGATGGAGAAATGGCTGCCCGCC
AAGCAGACTCGGGCTCCAATAACCATCAAAACAGAGTATGGCTGCATTTTCGGCATGTCCCGGCCTACTGGCGAC
CTCAGGGCAACTCATGCCCACCTGGTGCACAAGAAGCATGTCAGCATCACCTGCTTGGGCGGCCCAGGCGATAGA
CTGTATTGGTTTCTCTTCTTCAAACTCCCTCGAGCTCACTTGGGACACGACTATCCACAGTGCTCCAAGGCAGAT
GAAAGAGCACTCGTTGCACAGGAAGCCGAAACCCGCCTGACGCCCAGTGTCTGCTTCAAGCAGCTCCATGACAAC
CTCATCTTGTGCAGAACGACGCCCTTGCCGCAGTACCTTGTTGCAGAGTGGCATTACCGACGCATCATGCTGCTT
GGCGACTCGGCACACAAGGTATGCCAAGACTCTTCTCGTGGCTCTCTGGTGGCTCTCTGGTGGCAGGCTCTCTCT
CTAATGGCCCTCTAGCTCCATCCCCTGACTGGCCAAGGTGGCAACCTGGCTCTCGAGGCTGCGGCAGCCTTGGCA
GACTGCCTCTGGAATGCCCTCAAAGACGGCCATGGCAGCCCATCAGCCCAGCAAATCGACTCGGCCTTTTCTCAC
GCACAGCAGCTGTGCCAACAACGAGCGGCCCGTCTCGTCGAGAGCAGCTTCCAGGAATACCGCATGGCATCGTGG
GCCAACAAGGCCTATGAAATCATGGACTGCTACCTCGTGCCGCACCTTGATACGCCCATGCTCGTCGACAGAATC
AGCTCCTATATTGTTGGCGGCTACCAGTCGCAATGCATAGTCGGCAAGAGCAACAAGGCACCGCCCACGCACTGC
ATCCCCTATTACAACGAGCTGGCGCATAAGCCAGCATTGCATAGCTCCCAGCTCCTATACATCGTGGCCGGCTAC
CTCGTGCTGCTCTCCATGGCCGTGCATGTGGCAAATCGCTTGCCCCGCGTATGCGAGCTTGCTGCTGCTCTTCCT
CACCAGCAACATGTTGGCAGCCTCGACTATGCTCCCTTGCTTGATGCCTGCTCCTCCTCTCTCTACGCCTTCTTC
TCGGCCGCTGGGTGGAATCCTACTTACAGGCTGCTCATATTCTACTCCTTTGCCTCTCAGTCGCTAGTCTTTGCC
ACATGGACCATGGAGTCGTGCCGGCCTCGGAGCAGCATCAAGCCCATTGCCCTTGTTCTCCTTGTAGAGTTCCTC
GCCCATTTCTCCGCCCTCAGAATCATGGTGCCCATCTTGTACTTGATTGACAACATGACGACGGTCCTTTCCAGC
CAGTGGTGGCCCACAGCAACATTTGTGACTCCGGCCAAGGCCAAGAGAGTACTGCCTGCCTGCGTCATTGGCCTA
TTTCTTCCGCTATTGCTCATGCTCAACCCTTTGTCTCCAAGCTACCTACGTCACGCTCTGACAGTCATGTACATG
GCTTGTCCCGTCTGGCTATATCTATGCAAGACTTGTCCTTTGCATACCATTCCCGAGCAAACTTATAGCCAATTG
GCAGCGCCCCAATCCGTTGCCCATATTCGCCAACTCTACACCACGCTTGCCATGATGACGGGCCTGGTATACATG
GGCACCGTCGCCTCCATCCTGGCATCAGTCGATGCTGGCTCTCGCCTTCAAAACGTCCTAGAGGTGCTTTGGTTC
CCATCTTGCCGCACCGCCGACCTCTATCAGCAAGCGCACATGCTGCTGCTTTGGCGCTTGTACACCTCGGCTGTT
CCTCTCCTGCTATGGAACTTTTACAGCTCGCTAGCAGCGAGTCGAGTTGGAATCAAACCTCTTGGTCCAATCCGG
CTCCTTGTTGCATTCTTGCTTGGCTCAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail