Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2974
Gene name
LocationContig_2:200274..200968
Strand+
Gene length (bp)694
Transcript length (bp)426
Coding sequence length (bp)426
Protein length (aa) 142

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00383 dCMP_cyt_deam_1 Cytidine and deoxycytidylate deaminase zinc-binding region 1.3E-15 10 104
PF08211 dCMP_cyt_deam_2 Cytidine and deoxycytidylate deaminase zinc-binding region 1.7E-06 10 75

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P56389|CDD_MOUSE Cytidine deaminase OS=Mus musculus GN=Cda PE=1 SV=2 5 138 6.0E-41
sp|P32320|CDD_HUMAN Cytidine deaminase OS=Homo sapiens GN=CDA PE=1 SV=2 2 140 7.0E-41
sp|Q9S3M0|CDD_SPOPS Cytidine deaminase OS=Sporosarcina psychrophila GN=cdd PE=3 SV=1 9 137 1.0E-33
sp|P19079|CDD_BACSU Cytidine deaminase OS=Bacillus subtilis (strain 168) GN=cdd PE=1 SV=1 11 137 4.0E-33
sp|Q9KD53|CDD_BACHD Cytidine deaminase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=cdd PE=3 SV=1 11 138 2.0E-31
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P56389|CDD_MOUSE Cytidine deaminase OS=Mus musculus GN=Cda PE=1 SV=2 5 138 6.0E-41
sp|P32320|CDD_HUMAN Cytidine deaminase OS=Homo sapiens GN=CDA PE=1 SV=2 2 140 7.0E-41
sp|Q9S3M0|CDD_SPOPS Cytidine deaminase OS=Sporosarcina psychrophila GN=cdd PE=3 SV=1 9 137 1.0E-33
sp|P19079|CDD_BACSU Cytidine deaminase OS=Bacillus subtilis (strain 168) GN=cdd PE=1 SV=1 11 137 4.0E-33
sp|Q9KD53|CDD_BACHD Cytidine deaminase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=cdd PE=3 SV=1 11 138 2.0E-31
sp|Q09190|CDD_SCHPO Putative cytidine deaminase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pcd1 PE=3 SV=2 5 138 2.0E-30
sp|Q06549|CDD_YEAST Cytidine deaminase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDD1 PE=1 SV=1 4 138 7.0E-30
sp|Q54I82|CDD_DICDI Probable cytidine deaminase OS=Dictyostelium discoideum GN=cda PE=3 SV=1 5 137 2.0E-25
sp|P47718|CDD_MYCPI Cytidine deaminase OS=Mycoplasma pirum GN=cdd PE=3 SV=1 22 138 2.0E-21
sp|P9WPH3|CDD_MYCTU Cytidine deaminase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cdd PE=1 SV=1 7 137 1.0E-18
sp|P9WPH2|CDD_MYCTO Cytidine deaminase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cdd PE=3 SV=1 7 137 1.0E-18
sp|P47298|CDD_MYCGE Cytidine deaminase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=cdd PE=3 SV=1 24 134 1.0E-14
sp|B5FEN2|CDD_VIBFM Cytidine deaminase OS=Vibrio fischeri (strain MJ11) GN=cdd PE=3 SV=1 26 137 6.0E-14
sp|B7VPF1|CDD_VIBTL Cytidine deaminase OS=Vibrio tasmaniensis (strain LGP32) GN=cdd PE=3 SV=1 20 141 9.0E-14
sp|P75051|CDD_MYCPN Cytidine deaminase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=cdd PE=3 SV=1 11 132 9.0E-14
sp|B4ESY3|CDD_PROMH Cytidine deaminase OS=Proteus mirabilis (strain HI4320) GN=cdd PE=3 SV=1 27 141 2.0E-13
sp|Q5E4R6|CDD_VIBF1 Cytidine deaminase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=cdd PE=3 SV=1 26 137 3.0E-13
sp|Q7MK48|CDD_VIBVY Cytidine deaminase OS=Vibrio vulnificus (strain YJ016) GN=cdd PE=3 SV=2 20 137 5.0E-13
sp|C5BCM4|CDD_EDWI9 Cytidine deaminase OS=Edwardsiella ictaluri (strain 93-146) GN=cdd PE=3 SV=1 27 138 8.0E-13
sp|Q8DA31|CDD_VIBVU Cytidine deaminase OS=Vibrio vulnificus (strain CMCP6) GN=cdd PE=3 SV=2 20 137 1.0E-12
sp|Q87Q52|CDD_VIBPA Cytidine deaminase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=cdd PE=3 SV=1 20 137 1.0E-12
sp|Q2NUD2|CDD_SODGM Cytidine deaminase OS=Sodalis glossinidius (strain morsitans) GN=cdd PE=3 SV=1 20 137 2.0E-12
sp|Q66C79|CDD_YERPS Cytidine deaminase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=cdd PE=3 SV=1 24 141 2.0E-12
sp|B2JZJ6|CDD_YERPB Cytidine deaminase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=cdd PE=3 SV=1 24 141 2.0E-12
sp|A5F1V7|CDD_VIBC3 Cytidine deaminase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=cdd PE=3 SV=1 20 137 3.0E-12
sp|C3LLS7|CDD_VIBCM Cytidine deaminase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=cdd PE=3 SV=1 20 137 3.0E-12
sp|Q9KSM5|CDD_VIBCH Cytidine deaminase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=cdd PE=1 SV=1 20 137 3.0E-12
sp|Q6LRI0|CDD_PHOPR Cytidine deaminase OS=Photobacterium profundum GN=cdd PE=3 SV=1 20 140 6.0E-12
sp|Q7N6K3|CDD_PHOLL Cytidine deaminase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=cdd PE=3 SV=1 27 141 6.0E-12
sp|B1JPZ5|CDD_YERPY Cytidine deaminase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=cdd PE=3 SV=1 24 141 1.0E-11
sp|A4TKN7|CDD_YERPP Cytidine deaminase OS=Yersinia pestis (strain Pestoides F) GN=cdd PE=3 SV=1 24 141 1.0E-11
sp|Q1CGT5|CDD_YERPN Cytidine deaminase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=cdd PE=3 SV=1 24 141 1.0E-11
sp|A9R1B9|CDD_YERPG Cytidine deaminase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=cdd PE=3 SV=1 24 141 1.0E-11
sp|Q8ZG08|CDD_YERPE Cytidine deaminase OS=Yersinia pestis GN=cdd PE=3 SV=1 24 141 1.0E-11
sp|Q1C9U7|CDD_YERPA Cytidine deaminase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=cdd PE=3 SV=1 24 141 1.0E-11
sp|A7FJK3|CDD_YERP3 Cytidine deaminase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=cdd PE=3 SV=1 24 141 1.0E-11
sp|A7MVH6|CDD_VIBCB Cytidine deaminase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=cdd PE=3 SV=1 20 137 5.0E-11
sp|O65896|CDA1_ARATH Cytidine deaminase 1 OS=Arabidopsis thaliana GN=CDA1 PE=1 SV=1 11 137 7.0E-11
sp|B5BE52|CDD_SALPK Cytidine deaminase OS=Salmonella paratyphi A (strain AKU_12601) GN=cdd PE=3 SV=1 29 138 7.0E-11
sp|Q5PE68|CDD_SALPA Cytidine deaminase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=cdd PE=3 SV=1 29 138 7.0E-11
sp|Q8Z5A8|CDD_SALTI Cytidine deaminase OS=Salmonella typhi GN=cdd PE=3 SV=1 29 138 8.0E-11
sp|B4SY15|CDD_SALNS Cytidine deaminase OS=Salmonella newport (strain SL254) GN=cdd PE=3 SV=1 29 138 8.0E-11
sp|B5FMZ9|CDD_SALDC Cytidine deaminase OS=Salmonella dublin (strain CT_02021853) GN=cdd PE=3 SV=1 29 138 8.0E-11
sp|B5EYN3|CDD_SALA4 Cytidine deaminase OS=Salmonella agona (strain SL483) GN=cdd PE=3 SV=1 29 138 8.0E-11
sp|Q8ZNM0|CDD_SALTY Cytidine deaminase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cdd PE=3 SV=1 29 138 8.0E-11
sp|C0Q0V4|CDD_SALPC Cytidine deaminase OS=Salmonella paratyphi C (strain RKS4594) GN=cdd PE=3 SV=1 29 138 8.0E-11
sp|A9N6L3|CDD_SALPB Cytidine deaminase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=cdd PE=3 SV=1 29 138 8.0E-11
sp|B4TAK5|CDD_SALHS Cytidine deaminase OS=Salmonella heidelberg (strain SL476) GN=cdd PE=3 SV=1 29 138 8.0E-11
sp|B5RC22|CDD_SALG2 Cytidine deaminase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=cdd PE=3 SV=1 29 138 8.0E-11
sp|B5R153|CDD_SALEP Cytidine deaminase OS=Salmonella enteritidis PT4 (strain P125109) GN=cdd PE=3 SV=1 29 138 8.0E-11
sp|Q57MF5|CDD_SALCH Cytidine deaminase OS=Salmonella choleraesuis (strain SC-B67) GN=cdd PE=3 SV=1 29 138 9.0E-11
sp|A8GC32|CDD_SERP5 Cytidine deaminase OS=Serratia proteamaculans (strain 568) GN=cdd PE=3 SV=1 27 141 2.0E-10
sp|B4TNP0|CDD_SALSV Cytidine deaminase OS=Salmonella schwarzengrund (strain CVM19633) GN=cdd PE=3 SV=1 29 138 3.0E-10
sp|A9MKS5|CDD_SALAR Cytidine deaminase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=cdd PE=3 SV=1 29 138 6.0E-10
sp|B2VIF3|CDD_ERWT9 Cytidine deaminase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=cdd PE=3 SV=1 20 141 8.0E-10
sp|A8AE87|CDD_CITK8 Cytidine deaminase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=cdd PE=3 SV=1 29 138 9.0E-10
sp|B1IYC6|CDD_ECOLC Cytidine deaminase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=cdd PE=3 SV=1 2 138 9.0E-10
sp|Q32EM3|CDD_SHIDS Cytidine deaminase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=cdd PE=3 SV=1 2 138 1.0E-09
sp|A7ZNW5|CDD_ECO24 Cytidine deaminase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=cdd PE=3 SV=1 2 138 1.0E-09
sp|Q3Z062|CDD_SHISS Cytidine deaminase OS=Shigella sonnei (strain Ss046) GN=cdd PE=3 SV=1 2 138 1.0E-09
sp|P0ABF7|CDD_SHIFL Cytidine deaminase OS=Shigella flexneri GN=cdd PE=3 SV=1 2 138 1.0E-09
sp|Q0T2Y0|CDD_SHIF8 Cytidine deaminase OS=Shigella flexneri serotype 5b (strain 8401) GN=cdd PE=3 SV=1 2 138 1.0E-09
sp|Q322V3|CDD_SHIBS Cytidine deaminase OS=Shigella boydii serotype 4 (strain Sb227) GN=cdd PE=3 SV=1 2 138 1.0E-09
sp|B2TVV2|CDD_SHIB3 Cytidine deaminase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=cdd PE=3 SV=1 2 138 1.0E-09
sp|B1LKP0|CDD_ECOSM Cytidine deaminase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=cdd PE=3 SV=1 2 138 1.0E-09
sp|B6I8J3|CDD_ECOSE Cytidine deaminase OS=Escherichia coli (strain SE11) GN=cdd PE=3 SV=1 2 138 1.0E-09
sp|P0ABF6|CDD_ECOLI Cytidine deaminase OS=Escherichia coli (strain K12) GN=cdd PE=1 SV=1 2 138 1.0E-09
sp|A8A204|CDD_ECOHS Cytidine deaminase OS=Escherichia coli O9:H4 (strain HS) GN=cdd PE=3 SV=1 2 138 1.0E-09
sp|B1X7N2|CDD_ECODH Cytidine deaminase OS=Escherichia coli (strain K12 / DH10B) GN=cdd PE=3 SV=1 2 138 1.0E-09
sp|C4ZSM3|CDD_ECOBW Cytidine deaminase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=cdd PE=3 SV=1 2 138 1.0E-09
sp|B7M4Y8|CDD_ECO8A Cytidine deaminase OS=Escherichia coli O8 (strain IAI1) GN=cdd PE=3 SV=1 2 138 1.0E-09
sp|B7LA09|CDD_ECO55 Cytidine deaminase OS=Escherichia coli (strain 55989 / EAEC) GN=cdd PE=3 SV=1 2 138 1.0E-09
sp|B0TQV3|CDD_SHEHH Cytidine deaminase OS=Shewanella halifaxensis (strain HAW-EB4) GN=cdd PE=3 SV=1 27 140 1.0E-09
sp|Q1R9T0|CDD_ECOUT Cytidine deaminase OS=Escherichia coli (strain UTI89 / UPEC) GN=cdd PE=3 SV=1 2 138 1.0E-09
sp|B7NCH2|CDD_ECOLU Cytidine deaminase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=cdd PE=3 SV=1 2 138 1.0E-09
sp|Q8FFV3|CDD_ECOL6 Cytidine deaminase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cdd PE=3 SV=1 2 138 1.0E-09
sp|Q0TFU8|CDD_ECOL5 Cytidine deaminase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=cdd PE=3 SV=1 2 138 1.0E-09
sp|A1AD04|CDD_ECOK1 Cytidine deaminase OS=Escherichia coli O1:K1 / APEC GN=cdd PE=3 SV=1 2 138 1.0E-09
sp|B7MXF5|CDD_ECO81 Cytidine deaminase OS=Escherichia coli O81 (strain ED1a) GN=cdd PE=3 SV=1 2 138 1.0E-09
sp|B7MF55|CDD_ECO45 Cytidine deaminase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=cdd PE=3 SV=1 2 138 1.0E-09
sp|B7UFF9|CDD_ECO27 Cytidine deaminase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=cdd PE=3 SV=1 2 138 1.0E-09
sp|B7LVA3|CDD_ESCF3 Cytidine deaminase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=cdd PE=3 SV=1 2 138 1.0E-09
sp|A4WCI1|CDD_ENT38 Cytidine deaminase OS=Enterobacter sp. (strain 638) GN=cdd PE=3 SV=1 29 138 1.0E-09
sp|Q9SU86|CDA6_ARATH Cytidine deaminase 6 OS=Arabidopsis thaliana GN=CDA6 PE=3 SV=1 19 139 1.0E-09
sp|Q083S7|CDD_SHEFN Cytidine deaminase OS=Shewanella frigidimarina (strain NCIMB 400) GN=cdd PE=3 SV=1 2 140 3.0E-09
sp|B7NMA8|CDD_ECO7I Cytidine deaminase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=cdd PE=3 SV=1 2 138 3.0E-09
sp|P44325|CDD_HAEIN Cytidine deaminase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=cdd PE=3 SV=1 20 137 4.0E-09
sp|A5UEI7|CDD_HAEIG Cytidine deaminase OS=Haemophilus influenzae (strain PittGG) GN=cdd PE=3 SV=1 20 137 5.0E-09
sp|B8CR83|CDD_SHEPW Cytidine deaminase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=cdd PE=3 SV=1 26 140 5.0E-09
sp|Q4QK60|CDD_HAEI8 Cytidine deaminase OS=Haemophilus influenzae (strain 86-028NP) GN=cdd PE=3 SV=1 20 137 5.0E-09
sp|A5UBV9|CDD_HAEIE Cytidine deaminase OS=Haemophilus influenzae (strain PittEE) GN=cdd PE=3 SV=1 20 137 5.0E-09
sp|A1S723|CDD_SHEAM Cytidine deaminase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=cdd PE=3 SV=1 27 141 7.0E-09
sp|A8FWK2|CDD_SHESH Cytidine deaminase OS=Shewanella sediminis (strain HAW-EB3) GN=cdd PE=3 SV=1 27 140 8.0E-09
sp|P33967|BSR_BACCE Blasticidin-S deaminase OS=Bacillus cereus GN=bsr PE=1 SV=1 1 132 9.0E-09
sp|A9KXF0|CDD_SHEB9 Cytidine deaminase OS=Shewanella baltica (strain OS195) GN=cdd PE=3 SV=1 27 141 9.0E-09
sp|A6WLY5|CDD_SHEB8 Cytidine deaminase OS=Shewanella baltica (strain OS185) GN=cdd PE=3 SV=1 27 141 9.0E-09
sp|A3D392|CDD_SHEB5 Cytidine deaminase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=cdd PE=3 SV=1 27 141 9.0E-09
sp|B8EF35|CDD_SHEB2 Cytidine deaminase OS=Shewanella baltica (strain OS223) GN=cdd PE=3 SV=1 27 141 9.0E-09
sp|A0KYD1|CDD_SHESA Cytidine deaminase OS=Shewanella sp. (strain ANA-3) GN=cdd PE=3 SV=1 27 141 9.0E-09
sp|Q8EDG1|CDD_SHEON Cytidine deaminase OS=Shewanella oneidensis (strain MR-1) GN=cdd PE=3 SV=1 27 141 1.0E-08
sp|Q0HHI5|CDD_SHESM Cytidine deaminase OS=Shewanella sp. (strain MR-4) GN=cdd PE=3 SV=1 27 141 1.0E-08
sp|Q0HTT9|CDD_SHESR Cytidine deaminase OS=Shewanella sp. (strain MR-7) GN=cdd PE=3 SV=1 27 141 1.0E-08
sp|B1KRC5|CDD_SHEWM Cytidine deaminase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=cdd PE=3 SV=1 27 140 1.0E-08
sp|A8H5H1|CDD_SHEPA Cytidine deaminase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=cdd PE=3 SV=1 27 140 1.0E-08
sp|A1RL10|CDD_SHESW Cytidine deaminase OS=Shewanella sp. (strain W3-18-1) GN=cdd PE=3 SV=1 27 141 1.0E-08
sp|A4Y5R0|CDD_SHEPC Cytidine deaminase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=cdd PE=3 SV=1 27 141 1.0E-08
sp|A7MLJ4|CDD_CROS8 Cytidine deaminase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=cdd PE=3 SV=1 29 138 2.0E-08
sp|Q3IBX5|CDD_PSEHT Cytidine deaminase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=cdd PE=3 SV=1 13 137 6.0E-08
sp|C6DDS7|CDD_PECCP Cytidine deaminase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=cdd PE=3 SV=1 27 138 9.0E-08
sp|B0BQT2|CDD_ACTPJ Cytidine deaminase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=cdd PE=3 SV=1 24 138 1.0E-07
sp|B3GYC3|CDD_ACTP7 Cytidine deaminase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=cdd PE=3 SV=1 24 138 1.0E-07
sp|A3N1Z1|CDD_ACTP2 Cytidine deaminase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=cdd PE=3 SV=1 24 138 1.0E-07
sp|A0KJH4|CDD_AERHH Cytidine deaminase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=cdd PE=3 SV=1 5 140 1.0E-07
sp|B5XP65|CDD_KLEP3 Cytidine deaminase OS=Klebsiella pneumoniae (strain 342) GN=cdd PE=3 SV=1 29 138 2.0E-07
sp|A6TBN1|CDD_KLEP7 Cytidine deaminase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=cdd PE=3 SV=1 29 138 2.0E-07
sp|Q7VMJ6|CDD_HAEDU Cytidine deaminase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=cdd PE=3 SV=1 24 138 3.0E-07
sp|A3QDC9|CDD_SHELP Cytidine deaminase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=cdd PE=3 SV=1 27 138 6.0E-07
sp|O65571|CDA2_ARATH Cytidine deaminase 2 OS=Arabidopsis thaliana GN=CDA2 PE=2 SV=1 12 129 8.0E-07
sp|A4SNI2|CDD_AERS4 Cytidine deaminase OS=Aeromonas salmonicida (strain A449) GN=cdd PE=3 SV=1 27 140 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0009972 cytidine deamination Yes
GO:0008270 zinc ion binding Yes
GO:0004126 cytidine deaminase activity Yes
GO:0072529 pyrimidine-containing compound catabolic process No
GO:1901565 organonitrogen compound catabolic process No
GO:0044270 cellular nitrogen compound catabolic process No
GO:0034655 nucleobase-containing compound catabolic process No
GO:0046700 heterocycle catabolic process No
GO:0046135 pyrimidine nucleoside catabolic process No
GO:0043167 ion binding No
GO:0046087 cytidine metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:1901361 organic cyclic compound catabolic process No
GO:1901657 glycosyl compound metabolic process No
GO:1901658 glycosyl compound catabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0016814 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amidines No
GO:0016787 hydrolase activity No
GO:0005488 binding No
GO:0034656 nucleobase-containing small molecule catabolic process No
GO:0046131 pyrimidine ribonucleoside metabolic process No
GO:0008150 biological_process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0009164 nucleoside catabolic process No
GO:1901136 carbohydrate derivative catabolic process No
GO:0046914 transition metal ion binding No
GO:1901575 organic substance catabolic process No
GO:0044281 small molecule metabolic process No
GO:0009116 nucleoside metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0046133 pyrimidine ribonucleoside catabolic process No
GO:0072527 pyrimidine-containing compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0019439 aromatic compound catabolic process No
GO:0019239 deaminase activity No
GO:0044238 primary metabolic process No
GO:0009987 cellular process No
GO:0008152 metabolic process No
GO:0044237 cellular metabolic process No
GO:0071704 organic substance metabolic process No
GO:0009056 catabolic process No
GO:0042454 ribonucleoside catabolic process No
GO:0009119 ribonucleoside metabolic process No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:0044248 cellular catabolic process No
GO:0043169 cation binding No
GO:0003824 catalytic activity No
GO:0046872 metal ion binding No
GO:0016810 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds No
GO:0044282 small molecule catabolic process No
GO:0006216 cytidine catabolic process No
GO:0006213 pyrimidine nucleoside metabolic process No
GO:1901360 organic cyclic compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2974
MATGLTPDQTQRLQSAATQAKATAYCPYSHFSVGAAVLGTDGNIIPGANVENASYPVGSCAERVAVARAVTQGTR
EFCALAVASDVSPPASPCGMCRQFIREFCSLDMPILMLGPQDECVVRTLGELLPMSFGPEQLKPTS*
Coding >OphauB2|2974
ATGGCCACAGGTCTGACGCCCGATCAGACTCAGCGCCTCCAGAGCGCCGCTACTCAGGCCAAGGCTACTGCCTAC
TGCCCCTACAGCCACTTCAGCGTCGGTGCTGCAGTGCTTGGCACCGACGGCAACATTATCCCTGGTGCAAACGTG
GAGAATGCCAGCTACCCTGTTGGCTCGTGTGCAGAGCGTGTTGCCGTGGCGCGGGCAGTAACCCAAGGCACGCGA
GAGTTTTGTGCCTTGGCCGTGGCGTCGGATGTGAGTCCGCCGGCTAGTCCATGTGGCATGTGTCGTCAGTTTATC
CGCGAATTTTGCTCTCTCGATATGCCCATCTTGATGCTTGGTCCTCAGGACGAGTGTGTGGTGCGCACGCTAGGA
GAGCTGCTTCCCATGTCCTTCGGCCCCGAGCAGCTCAAGCCGACGTCTTGA
Transcript >OphauB2|2974
ATGGCCACAGGTCTGACGCCCGATCAGACTCAGCGCCTCCAGAGCGCCGCTACTCAGGCCAAGGCTACTGCCTAC
TGCCCCTACAGCCACTTCAGCGTCGGTGCTGCAGTGCTTGGCACCGACGGCAACATTATCCCTGGTGCAAACGTG
GAGAATGCCAGCTACCCTGTTGGCTCGTGTGCAGAGCGTGTTGCCGTGGCGCGGGCAGTAACCCAAGGCACGCGA
GAGTTTTGTGCCTTGGCCGTGGCGTCGGATGTGAGTCCGCCGGCTAGTCCATGTGGCATGTGTCGTCAGTTTATC
CGCGAATTTTGCTCTCTCGATATGCCCATCTTGATGCTTGGTCCTCAGGACGAGTGTGTGGTGCGCACGCTAGGA
GAGCTGCTTCCCATGTCCTTCGGCCCCGAGCAGCTCAAGCCGACGTCTTGA
Gene >OphauB2|2974
ATGGCCACAGGTCTGACGCCCGATCAGACTCAGCGCCTCCAGAGCGCCGCTACTCAGGCCAAGGCTACTGCCTAC
TGCCCCTACAGCCACTTCAGCGTCGGTGCTGCAGTGCTTGGCACCGACGGCAACATTATCCCTGGTGCAAACGTG
GAGAATGCCAGCTACCCTGTTGGCTCGTGTGCAGAGCGTGTTGCCGTGGCGCGGGCAGTAACCCAAGGCACGCGA
GAGTTTTGTGCCTTGGCCGTGGCGTCGGATGTGAGTCCGCCGGCTAGTCCATGTGGCATGTGTCGTCAGTTGTGA
GTCTTTTTTTTTTATCTTTTTTCTTTTTCCCCCCAAAGGTCTCTTCTTATTCTATTTTTCTTCCTGGCTTCCTTT
TGTTTCATTTTGTGGTTTTCTCTTTTTTGAGGGCAGGATGGGGAAGGGGTTCGTGACTAGAAAACCAGAAGCAAA
GGCTGCAACTGACCATTAAGTAAACTGCTTAGTATCCGCGAATTTTGCTCTCTCGATATGCCCATCTTGATGCTT
GGTCCTCAGGACGAGTGTGTGGTGCGCACGCTAGGAGAGGTGGGCTGGCAACGCTCCTTTGAAGGCTGATATTCT
GTGGCATAAGTGCCGTGATTTCCTGGCTGACTTGCAAGTGTAATAGCTGCTTCCCATGTCCTTCGGCCCCGAGCA
GCTCAAGCCGACGTCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail