Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2973
Gene name
LocationContig_2:195485..199651
Strand+
Gene length (bp)4166
Transcript length (bp)4104
Coding sequence length (bp)4104
Protein length (aa) 1368

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00069 Pkinase Protein kinase domain 2.1E-69 1049 1317
PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase 1.2E-37 1051 1313

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14299|WIS4_SCHPO MAP kinase kinase kinase wis4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wis4 PE=3 SV=1 142 1339 0.0E+00
sp|O74304|WIN1_SCHPO MAP kinase kinase kinase win1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=win1 PE=1 SV=1 174 1334 0.0E+00
sp|P53599|SSK2_YEAST MAP kinase kinase kinase SSK2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSK2 PE=1 SV=1 745 1321 2.0E-150
sp|P25390|SSK22_YEAST Serine/threonine-protein kinase SSK22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSK22 PE=1 SV=2 746 1321 2.0E-145
sp|Q9Y6R4|M3K4_HUMAN Mitogen-activated protein kinase kinase kinase 4 OS=Homo sapiens GN=MAP3K4 PE=1 SV=2 998 1317 1.0E-63
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14299|WIS4_SCHPO MAP kinase kinase kinase wis4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wis4 PE=3 SV=1 142 1339 0.0E+00
sp|O74304|WIN1_SCHPO MAP kinase kinase kinase win1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=win1 PE=1 SV=1 174 1334 0.0E+00
sp|P53599|SSK2_YEAST MAP kinase kinase kinase SSK2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSK2 PE=1 SV=1 745 1321 2.0E-150
sp|P25390|SSK22_YEAST Serine/threonine-protein kinase SSK22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSK22 PE=1 SV=2 746 1321 2.0E-145
sp|Q9Y6R4|M3K4_HUMAN Mitogen-activated protein kinase kinase kinase 4 OS=Homo sapiens GN=MAP3K4 PE=1 SV=2 998 1317 1.0E-63
sp|O08648|M3K4_MOUSE Mitogen-activated protein kinase kinase kinase 4 OS=Mus musculus GN=Map3k4 PE=1 SV=2 1017 1317 1.0E-61
sp|O22042|M3K3_ARATH Mitogen-activated protein kinase kinase kinase 3 OS=Arabidopsis thaliana GN=ANP3 PE=1 SV=1 1045 1323 2.0E-58
sp|Q9CAD5|YODA_ARATH Mitogen-activated protein kinase kinase kinase YODA OS=Arabidopsis thaliana GN=YDA PE=1 SV=1 1047 1340 1.0E-57
sp|Q10407|MKH1_SCHPO MAP kinase kinase kinase mkh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mkh1 PE=3 SV=1 1021 1317 2.0E-57
sp|Q9FZ36|M3K2_ARATH Mitogen-activated protein kinase kinase kinase 2 OS=Arabidopsis thaliana GN=ANP2 PE=2 SV=1 1046 1317 3.0E-57
sp|Q54R82|MKKA_DICDI Mitogen-activated protein kinase kinase kinase A OS=Dictyostelium discoideum GN=mkkA PE=1 SV=2 1042 1328 4.0E-57
sp|O22040|ANP1_ARATH Mitogen-activated protein kinase kinase kinase ANP1 OS=Arabidopsis thaliana GN=ANP1 PE=1 SV=2 1046 1346 3.0E-56
sp|Q40541|NPK1_TOBAC Mitogen-activated protein kinase kinase kinase NPK1 OS=Nicotiana tabacum GN=NPK1 PE=1 SV=1 1046 1319 6.0E-56
sp|P53599|SSK2_YEAST MAP kinase kinase kinase SSK2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSK2 PE=1 SV=1 212 724 1.0E-51
sp|Q01389|BCK1_YEAST Serine/threonine-protein kinase BCK1/SLK1/SSP31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BCK1 PE=1 SV=1 1048 1316 2.0E-51
sp|Q56UN5|M3K19_HUMAN Mitogen-activated protein kinase kinase kinase 19 OS=Homo sapiens GN=MAP3K19 PE=2 SV=1 1048 1317 4.0E-51
sp|Q39008|M3K1_ARATH Mitogen-activated protein kinase kinase kinase 1 OS=Arabidopsis thaliana GN=MEKK1 PE=1 SV=2 1026 1317 1.0E-50
sp|E9Q3S4|M3K19_MOUSE Mitogen-activated protein kinase kinase kinase 19 OS=Mus musculus GN=Map3k19 PE=3 SV=1 1048 1317 3.0E-49
sp|P28829|BYR2_SCHPO Protein kinase byr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=byr2 PE=1 SV=1 1045 1317 3.0E-48
sp|Q0CL79|SEPH_ASPTN Cytokinesis protein sepH OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sepH PE=3 SV=2 1037 1332 5.0E-48
sp|O81472|MP3K2_ARATH Mitogen-activated protein kinase kinase kinase 9 OS=Arabidopsis thaliana GN=MEKK2 PE=1 SV=1 1026 1317 7.0E-48
sp|Q55CA6|Y0146_DICDI Probable serine/threonine-protein kinase DDB_G0270146 OS=Dictyostelium discoideum GN=DDB_G0270146 PE=3 SV=1 1027 1325 2.0E-47
sp|A0A078CGE6|M3KE1_BRANA MAP3K epsilon protein kinase 1 OS=Brassica napus GN=M3KE1 PE=1 SV=1 1047 1317 5.0E-47
sp|Q9LJD8|M3KE1_ARATH MAP3K epsilon protein kinase 1 OS=Arabidopsis thaliana GN=M3KE1 PE=1 SV=1 1047 1317 5.0E-47
sp|A2QHV0|SEPH_ASPNC Cytokinesis protein sepH OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=sepH PE=3 SV=1 1037 1340 8.0E-47
sp|Q54QI2|Y9877_DICDI Serine/threonine-protein kinase DDB_G0283821 OS=Dictyostelium discoideum GN=DDB_G0283821 PE=3 SV=1 1047 1346 2.0E-46
sp|A7A1P0|STE11_YEAS7 Serine/threonine-protein kinase STE11 OS=Saccharomyces cerevisiae (strain YJM789) GN=STE11 PE=3 SV=1 1048 1319 4.0E-46
sp|P23561|STE11_YEAST Serine/threonine-protein kinase STE11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE11 PE=1 SV=3 1048 1319 5.0E-46
sp|Q5B4Z3|SEPH_EMENI Cytokinesis protein sepH OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sepH PE=3 SV=2 1048 1332 5.0E-46
sp|Q9SFB6|M3KE2_ARATH MAP3K epsilon protein kinase 2 OS=Arabidopsis thaliana GN=MAP3KE2 PE=2 SV=1 1047 1317 6.0E-46
sp|P25390|SSK22_YEAST Serine/threonine-protein kinase SSK22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSK22 PE=1 SV=2 160 720 7.0E-46
sp|Q99759|M3K3_HUMAN Mitogen-activated protein kinase kinase kinase 3 OS=Homo sapiens GN=MAP3K3 PE=1 SV=2 1037 1316 8.0E-46
sp|Q61084|M3K3_MOUSE Mitogen-activated protein kinase kinase kinase 3 OS=Mus musculus GN=Map3k3 PE=1 SV=1 1037 1316 8.0E-46
sp|P41892|CDC7_SCHPO Cell division control protein 7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc7 PE=1 SV=1 1041 1318 1.0E-45
sp|Q8T2I8|SEPA_DICDI Serine/threonine-protein kinase sepA OS=Dictyostelium discoideum GN=sepA PE=2 SV=1 1043 1359 3.0E-45
sp|B5VNQ3|STE11_YEAS6 Serine/threonine-protein kinase STE11 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=STE11 PE=3 SV=2 1048 1319 3.0E-45
sp|O35099|M3K5_MOUSE Mitogen-activated protein kinase kinase kinase 5 OS=Mus musculus GN=Map3k5 PE=1 SV=3 1054 1344 2.0E-43
sp|Q99683|M3K5_HUMAN Mitogen-activated protein kinase kinase kinase 5 OS=Homo sapiens GN=MAP3K5 PE=1 SV=1 1054 1344 2.0E-43
sp|Q9WTR2|M3K6_MOUSE Mitogen-activated protein kinase kinase kinase 6 OS=Mus musculus GN=Map3k6 PE=1 SV=4 1054 1355 4.0E-43
sp|Q9SZ67|WRK19_ARATH Probable WRKY transcription factor 19 OS=Arabidopsis thaliana GN=WRKY19 PE=2 SV=1 1048 1317 8.0E-43
sp|Q9Y2U5|M3K2_HUMAN Mitogen-activated protein kinase kinase kinase 2 OS=Homo sapiens GN=MAP3K2 PE=1 SV=2 1039 1317 1.0E-42
sp|Q21029|NSY1_CAEEL Mitogen-activated protein kinase kinase kinase nsy-1 OS=Caenorhabditis elegans GN=nsy-1 PE=1 SV=4 1021 1317 1.0E-42
sp|Q61083|M3K2_MOUSE Mitogen-activated protein kinase kinase kinase 2 OS=Mus musculus GN=Map3k2 PE=1 SV=2 1039 1317 3.0E-42
sp|Q86IX1|DST1_DICDI Serine/threonine-protein kinase dst1 OS=Dictyostelium discoideum GN=dst1 PE=3 SV=1 1054 1326 7.0E-42
sp|Q54XJ4|Y8901_DICDI Probable serine/threonine-protein kinase DDB_G0278901 OS=Dictyostelium discoideum GN=DDB_G0278901 PE=3 SV=1 1053 1329 2.0E-41
sp|A2AQW0|M3K15_MOUSE Mitogen-activated protein kinase kinase kinase 15 OS=Mus musculus GN=Map3k15 PE=1 SV=1 993 1340 2.0E-41
sp|Q55GC2|DST2_DICDI Serine/threonine-protein kinase dst2 OS=Dictyostelium discoideum GN=dst2 PE=3 SV=1 1054 1325 6.0E-41
sp|Q8NEV4|MYO3A_HUMAN Myosin-IIIa OS=Homo sapiens GN=MYO3A PE=2 SV=2 1048 1325 8.0E-41
sp|Q54PX0|Y4251_DICDI Probable serine/threonine-protein kinase DDB_G0284251 OS=Dictyostelium discoideum GN=DDB_G0284251 PE=3 SV=1 1051 1332 1.0E-40
sp|Q13233|M3K1_HUMAN Mitogen-activated protein kinase kinase kinase 1 OS=Homo sapiens GN=MAP3K1 PE=1 SV=4 1048 1314 2.0E-40
sp|P53349|M3K1_MOUSE Mitogen-activated protein kinase kinase kinase 1 OS=Mus musculus GN=Map3k1 PE=1 SV=3 1048 1314 2.0E-40
sp|Q6ZN16|M3K15_HUMAN Mitogen-activated protein kinase kinase kinase 15 OS=Homo sapiens GN=MAP3K15 PE=1 SV=2 993 1317 3.0E-40
sp|Q8K3H5|MYO3A_MOUSE Myosin-IIIa OS=Mus musculus GN=Myo3a PE=2 SV=1 1048 1325 3.0E-40
sp|Q8T0S6|HIPPO_DROME Serine/threonine-protein kinase hippo OS=Drosophila melanogaster GN=hpo PE=1 SV=1 1054 1317 4.0E-40
sp|Q62925|M3K1_RAT Mitogen-activated protein kinase kinase kinase 1 OS=Rattus norvegicus GN=Map3k1 PE=1 SV=1 1048 1314 4.0E-40
sp|O95382|M3K6_HUMAN Mitogen-activated protein kinase kinase kinase 6 OS=Homo sapiens GN=MAP3K6 PE=1 SV=3 1054 1344 8.0E-40
sp|F1NBT0|STK10_CHICK Serine/threonine-protein kinase 10 OS=Gallus gallus GN=STK10 PE=3 SV=2 1048 1322 1.0E-39
sp|O94804|STK10_HUMAN Serine/threonine-protein kinase 10 OS=Homo sapiens GN=STK10 PE=1 SV=1 1048 1322 2.0E-39
sp|O61122|SVKA_DICDI Serine/threonine-protein kinase svkA OS=Dictyostelium discoideum GN=svkA PE=1 SV=1 1054 1321 3.0E-39
sp|Q8IVH8|M4K3_HUMAN Mitogen-activated protein kinase kinase kinase kinase 3 OS=Homo sapiens GN=MAP4K3 PE=1 SV=1 1054 1317 6.0E-39
sp|Q99JP0|M4K3_MOUSE Mitogen-activated protein kinase kinase kinase kinase 3 OS=Mus musculus GN=Map4k3 PE=1 SV=4 1054 1317 7.0E-39
sp|Q802A6|STK4_SQUAC Serine/threonine-protein kinase 3/4 OS=Squalus acanthias GN=STK4 PE=2 SV=1 1054 1317 1.0E-38
sp|E1BK52|STK10_BOVIN Serine/threonine-protein kinase 10 OS=Bos taurus GN=STK10 PE=3 SV=3 1048 1322 1.0E-38
sp|Q6PA14|STK4_XENLA Serine/threonine-protein kinase 4 OS=Xenopus laevis GN=stk4 PE=2 SV=1 1054 1325 2.0E-38
sp|Q13188|STK3_HUMAN Serine/threonine-protein kinase 3 OS=Homo sapiens GN=STK3 PE=1 SV=2 1054 1317 2.0E-38
sp|Q7ZUQ3|STK3_DANRE Serine/threonine-protein kinase 3 OS=Danio rerio GN=stk3 PE=2 SV=1 1054 1321 4.0E-38
sp|Q6P3Q4|STK4_XENTR Serine/threonine-protein kinase 4 OS=Xenopus tropicalis GN=stk4 PE=2 SV=1 1054 1325 4.0E-38
sp|O55098|STK10_MOUSE Serine/threonine-protein kinase 10 OS=Mus musculus GN=Stk10 PE=1 SV=2 1048 1322 5.0E-38
sp|E9PTG8|STK10_RAT Serine/threonine-protein kinase 10 OS=Rattus norvegicus GN=Stk10 PE=1 SV=1 1048 1322 5.0E-38
sp|P35465|PAK1_RAT Serine/threonine-protein kinase PAK 1 OS=Rattus norvegicus GN=Pak1 PE=1 SV=3 1054 1317 6.0E-38
sp|Q924I2|M4K3_RAT Mitogen-activated protein kinase kinase kinase kinase 3 OS=Rattus norvegicus GN=Map4k3 PE=1 SV=2 1054 1317 6.0E-38
sp|Q13153|PAK1_HUMAN Serine/threonine-protein kinase PAK 1 OS=Homo sapiens GN=PAK1 PE=1 SV=2 1054 1317 6.0E-38
sp|Q8BPM2|M4K5_MOUSE Mitogen-activated protein kinase kinase kinase kinase 5 OS=Mus musculus GN=Map4k5 PE=1 SV=2 1054 1317 7.0E-38
sp|Q5E9L6|STK4_BOVIN Serine/threonine-protein kinase 4 OS=Bos taurus GN=STK4 PE=2 SV=1 1054 1317 7.0E-38
sp|O54748|STK3_RAT Serine/threonine-protein kinase 3 OS=Rattus norvegicus GN=Stk3 PE=1 SV=1 1054 1317 7.0E-38
sp|Q08E52|PAK1_BOVIN Serine/threonine-protein kinase PAK 1 OS=Bos taurus GN=PAK1 PE=1 SV=1 1054 1317 7.0E-38
sp|Q9JI11|STK4_MOUSE Serine/threonine-protein kinase 4 OS=Mus musculus GN=Stk4 PE=1 SV=1 1054 1317 8.0E-38
sp|Q54RV3|PAKG_DICDI Serine/threonine-protein kinase pakG OS=Dictyostelium discoideum GN=pakG PE=3 SV=1 1053 1318 1.0E-37
sp|P50527|STE20_SCHPO Serine/threonine-protein kinase shk1/pak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shk1 PE=1 SV=2 1001 1317 1.0E-37
sp|A4K2M3|STK4_PAPAN Serine/threonine-protein kinase 4 OS=Papio anubis GN=STK4 PE=3 SV=1 1054 1317 1.0E-37
sp|Q9JI10|STK3_MOUSE Serine/threonine-protein kinase 3 OS=Mus musculus GN=Stk3 PE=1 SV=1 1054 1317 1.0E-37
sp|Q9Y4K4|M4K5_HUMAN Mitogen-activated protein kinase kinase kinase kinase 5 OS=Homo sapiens GN=MAP4K5 PE=1 SV=1 1054 1317 1.0E-37
sp|A4K2T0|STK4_MACMU Serine/threonine-protein kinase 4 OS=Macaca mulatta GN=STK4 PE=3 SV=1 1054 1317 1.0E-37
sp|Q13043|STK4_HUMAN Serine/threonine-protein kinase 4 OS=Homo sapiens GN=STK4 PE=1 SV=2 1054 1317 1.0E-37
sp|Q556S2|PAKH_DICDI Serine/threonine-protein kinase pakH OS=Dictyostelium discoideum GN=pakH-1 PE=3 SV=1 1054 1317 1.0E-37
sp|A4K2Y1|STK4_CHLAE Serine/threonine-protein kinase 4 OS=Chlorocebus aethiops GN=STK4 PE=3 SV=1 1054 1317 1.0E-37
sp|O14047|PPK11_SCHPO Serine/threonine-protein kinase ppk11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ppk11 PE=3 SV=1 1052 1347 2.0E-37
sp|O88643|PAK1_MOUSE Serine/threonine-protein kinase PAK 1 OS=Mus musculus GN=Pak1 PE=1 SV=1 1054 1317 2.0E-37
sp|P08018|PBS2_YEAST MAP kinase kinase PBS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PBS2 PE=1 SV=4 1054 1325 2.0E-37
sp|A4K2P5|STK4_COLGU Serine/threonine-protein kinase 4 OS=Colobus guereza GN=STK4 PE=3 SV=1 1054 1317 2.0E-37
sp|A4K2S1|STK4_LEMCA Serine/threonine-protein kinase 4 OS=Lemur catta GN=STK4 PE=3 SV=1 1054 1317 3.0E-37
sp|Q9NB31|CST1_CAEEL Serine/threonine-protein kinase cst-1 OS=Caenorhabditis elegans GN=cst-1 PE=1 SV=1 1054 1317 4.0E-37
sp|P27636|CDC15_YEAST Cell division control protein 15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC15 PE=1 SV=3 1041 1317 4.0E-37
sp|Q62829|PAK3_RAT Serine/threonine-protein kinase PAK 3 OS=Rattus norvegicus GN=Pak3 PE=1 SV=1 1054 1317 5.0E-37
sp|O14305|SID1_SCHPO Serine/threonine-protein kinase sid1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sid1 PE=1 SV=1 1054 1317 5.0E-37
sp|A4K2Q5|STK4_OTOGA Serine/threonine-protein kinase 4 OS=Otolemur garnettii GN=STK4 PE=3 SV=1 1054 1317 5.0E-37
sp|Q8BYC6|TAOK3_MOUSE Serine/threonine-protein kinase TAO3 OS=Mus musculus GN=Taok3 PE=1 SV=2 1052 1317 6.0E-37
sp|Q61036|PAK3_MOUSE Serine/threonine-protein kinase PAK 3 OS=Mus musculus GN=Pak3 PE=1 SV=2 1054 1317 6.0E-37
sp|Q7YQL3|PAK3_PONPY Serine/threonine-protein kinase PAK 3 OS=Pongo pygmaeus GN=PAK3 PE=2 SV=1 1054 1317 8.0E-37
sp|Q7YQL4|PAK3_PANTR Serine/threonine-protein kinase PAK 3 OS=Pan troglodytes GN=PAK3 PE=2 SV=1 1054 1317 8.0E-37
sp|O75914|PAK3_HUMAN Serine/threonine-protein kinase PAK 3 OS=Homo sapiens GN=PAK3 PE=1 SV=2 1054 1317 8.0E-37
sp|Q8AXB4|PAK3_XENLA Serine/threonine-protein kinase PAK 3 OS=Xenopus laevis GN=pak3 PE=2 SV=1 1054 1317 9.0E-37
sp|Q8RXG3|M2K5_ARATH Mitogen-activated protein kinase kinase 5 OS=Arabidopsis thaliana GN=MKK5 PE=1 SV=2 1024 1318 1.0E-36
sp|P33886|WIS1_SCHPO Protein kinase wis1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=wis1 PE=1 SV=1 1054 1334 1.0E-36
sp|Q5ZJK4|STK4_CHICK Serine/threonine-protein kinase 4 OS=Gallus gallus GN=STK4 PE=2 SV=1 1054 1317 2.0E-36
sp|O61125|STK4_DICDI Serine/threonine-protein kinase 4 homolog A OS=Dictyostelium discoideum GN=krsA PE=1 SV=1 1054 1323 2.0E-36
sp|O80397|M2K4_ARATH Mitogen-activated protein kinase kinase 4 OS=Arabidopsis thaliana GN=MKK4 PE=1 SV=1 1050 1318 2.0E-36
sp|Q54JG7|DST4_DICDI Serine/threonine-protein kinase dst4 OS=Dictyostelium discoideum GN=dst4 PE=3 SV=1 1054 1317 2.0E-36
sp|Q6IP06|STK3_XENLA Serine/threonine-protein kinase 3 OS=Xenopus laevis GN=stk3 PE=2 SV=1 1054 1317 2.0E-36
sp|Q64303|PAK2_RAT Serine/threonine-protein kinase PAK 2 OS=Rattus norvegicus GN=Pak2 PE=1 SV=1 1047 1317 2.0E-36
sp|Q8CIN4|PAK2_MOUSE Serine/threonine-protein kinase PAK 2 OS=Mus musculus GN=Pak2 PE=1 SV=1 1047 1317 2.0E-36
sp|Q29502|PAK2_RABIT Serine/threonine-protein kinase PAK 2 OS=Oryctolagus cuniculus GN=PAK2 PE=2 SV=1 1054 1317 3.0E-36
sp|Q94A06|M2K1_ARATH Mitogen-activated protein kinase kinase 1 OS=Arabidopsis thaliana GN=MKK1 PE=1 SV=2 1054 1317 3.0E-36
sp|A4K2W5|STK4_AOTNA Serine/threonine-protein kinase 4 OS=Aotus nancymaae GN=STK4 PE=3 SV=1 1054 1317 3.0E-36
sp|A8XJW8|CST1_CAEBR Serine/threonine-protein kinase cst-1 OS=Caenorhabditis briggsae GN=cst-1 PE=3 SV=2 1054 1317 4.0E-36
sp|Q13177|PAK2_HUMAN Serine/threonine-protein kinase PAK 2 OS=Homo sapiens GN=PAK2 PE=1 SV=3 1054 1317 4.0E-36
sp|Q6DD27|TAOK3_XENLA Serine/threonine-protein kinase TAO3 OS=Xenopus laevis GN=taok3 PE=2 SV=1 1052 1317 4.0E-36
sp|Q9I9E0|TAOK3_CHICK Serine/threonine-protein kinase TAO3 OS=Gallus gallus GN=TAOK3 PE=2 SV=2 1052 1317 5.0E-36
sp|Q53UA7|TAOK3_RAT Serine/threonine-protein kinase TAO3 OS=Rattus norvegicus GN=Taok3 PE=1 SV=1 1052 1317 5.0E-36
sp|O95747|OXSR1_HUMAN Serine/threonine-protein kinase OSR1 OS=Homo sapiens GN=OXSR1 PE=1 SV=1 1053 1316 6.0E-36
sp|Q863I2|OXSR1_PIG Serine/threonine-protein kinase OSR1 OS=Sus scrofa GN=OXSR1 PE=2 SV=1 1053 1316 6.0E-36
sp|Q5R495|OXSR1_PONAB Serine/threonine-protein kinase OSR1 OS=Pongo abelii GN=OXSR1 PE=2 SV=1 1053 1316 6.0E-36
sp|Q869T7|PAKF_DICDI Serine/threonine-protein kinase pakF OS=Dictyostelium discoideum GN=pakF PE=3 SV=1 1054 1317 6.0E-36
sp|Q6P9R2|OXSR1_MOUSE Serine/threonine-protein kinase OSR1 OS=Mus musculus GN=Oxsr1 PE=1 SV=1 1053 1316 7.0E-36
sp|Q5R4F3|TAOK3_PONAB Serine/threonine-protein kinase TAO3 OS=Pongo abelii GN=TAOK3 PE=2 SV=1 1052 1317 9.0E-36
sp|Q9H2K8|TAOK3_HUMAN Serine/threonine-protein kinase TAO3 OS=Homo sapiens GN=TAOK3 PE=1 SV=2 1052 1317 1.0E-35
sp|Q7ZYJ0|TAO1B_XENLA Serine/threonine-protein kinase TAO1-B OS=Xenopus laevis GN=taok1-b PE=2 SV=1 1054 1325 1.0E-35
sp|Q9Y6E0|STK24_HUMAN Serine/threonine-protein kinase 24 OS=Homo sapiens GN=STK24 PE=1 SV=1 1054 1318 2.0E-35
sp|O55092|SLK_CAVPO STE20-like serine/threonine-protein kinase OS=Cavia porcellus GN=SLK PE=1 SV=1 1048 1317 2.0E-35
sp|Q12851|M4K2_HUMAN Mitogen-activated protein kinase kinase kinase kinase 2 OS=Homo sapiens GN=MAP4K2 PE=1 SV=2 1054 1344 3.0E-35
sp|Q55D99|PAKA_DICDI Serine/threonine-protein kinase pakA OS=Dictyostelium discoideum GN=pakA PE=1 SV=1 1054 1317 3.0E-35
sp|Q0IHQ8|STK10_XENTR Serine/threonine-protein kinase 10 OS=Xenopus tropicalis GN=stk10 PE=2 SV=1 1054 1320 4.0E-35
sp|O08815|SLK_RAT STE20-like serine/threonine-protein kinase OS=Rattus norvegicus GN=Slk PE=1 SV=1 1048 1317 4.0E-35
sp|Q09170|CDS1_SCHPO Serine/threonine-protein kinase cds1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cds1 PE=1 SV=2 1054 1334 4.0E-35
sp|Q5F2E8|TAOK1_MOUSE Serine/threonine-protein kinase TAO1 OS=Mus musculus GN=Taok1 PE=1 SV=1 1054 1325 4.0E-35
sp|O88664|TAOK1_RAT Serine/threonine-protein kinase TAO1 OS=Rattus norvegicus GN=Taok1 PE=1 SV=1 1054 1325 4.0E-35
sp|Q61161|M4K2_MOUSE Mitogen-activated protein kinase kinase kinase kinase 2 OS=Mus musculus GN=Map4k2 PE=1 SV=1 1054 1344 5.0E-35
sp|O54988|SLK_MOUSE STE20-like serine/threonine-protein kinase OS=Mus musculus GN=Slk PE=1 SV=2 1048 1317 5.0E-35
sp|B0LT89|STK24_RAT Serine/threonine-protein kinase 24 OS=Rattus norvegicus GN=Stk24 PE=2 SV=1 1054 1318 5.0E-35
sp|Q6GPK9|TAOK2_XENLA Serine/threonine-protein kinase TAO2 OS=Xenopus laevis GN=taok2 PE=2 SV=1 1054 1325 5.0E-35
sp|Q99KH8|STK24_MOUSE Serine/threonine-protein kinase 24 OS=Mus musculus GN=Stk24 PE=1 SV=1 1054 1318 7.0E-35
sp|Q9H2G2|SLK_HUMAN STE20-like serine/threonine-protein kinase OS=Homo sapiens GN=SLK PE=1 SV=1 1048 1317 7.0E-35
sp|Q7L7X3|TAOK1_HUMAN Serine/threonine-protein kinase TAO1 OS=Homo sapiens GN=TAOK1 PE=1 SV=1 1054 1325 7.0E-35
sp|Q9VXE5|PAKM_DROME Serine/threonine-protein kinase PAK mbt OS=Drosophila melanogaster GN=mbt PE=1 SV=2 1052 1317 7.0E-35
sp|Q1EG27|MYO3B_MOUSE Myosin-IIIb OS=Mus musculus GN=Myo3b PE=2 SV=2 1048 1325 1.0E-34
sp|Q9S7U9|M2K2_ARATH Mitogen-activated protein kinase kinase 2 OS=Arabidopsis thaliana GN=MKK2 PE=1 SV=2 1054 1317 1.0E-34
sp|B7ZR30|STK10_XENLA Serine/threonine-protein kinase 10-A OS=Xenopus laevis GN=stk10-a PE=1 SV=1 1054 1317 1.0E-34
sp|O00506|STK25_HUMAN Serine/threonine-protein kinase 25 OS=Homo sapiens GN=STK25 PE=1 SV=1 1054 1317 2.0E-34
sp|Q9Z2W1|STK25_MOUSE Serine/threonine-protein kinase 25 OS=Mus musculus GN=Stk25 PE=1 SV=2 1054 1317 2.0E-34
sp|Q92918|M4K1_HUMAN Mitogen-activated protein kinase kinase kinase kinase 1 OS=Homo sapiens GN=MAP4K1 PE=1 SV=1 1054 1317 2.0E-34
sp|Q9SN43|CIPKC_ARATH CBL-interacting serine/threonine-protein kinase 12 OS=Arabidopsis thaliana GN=CIPK12 PE=1 SV=1 1038 1317 3.0E-34
sp|O96013|PAK4_HUMAN Serine/threonine-protein kinase PAK 4 OS=Homo sapiens GN=PAK4 PE=1 SV=1 1054 1317 4.0E-34
sp|Q7SY52|STK10_DANRE Serine/threonine-protein kinase 10 OS=Danio rerio GN=stk10 PE=2 SV=1 1048 1322 4.0E-34
sp|Q12263|GIN4_YEAST Serine/threonine-protein kinase GIN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIN4 PE=1 SV=1 1048 1314 4.0E-34
sp|Q8BTW9|PAK4_MOUSE Serine/threonine-protein kinase PAK 4 OS=Mus musculus GN=Pak4 PE=1 SV=1 1054 1317 4.0E-34
sp|Q10056|SHK2_SCHPO Serine/threonine-protein kinase shk2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=shk2 PE=3 SV=1 1052 1317 4.0E-34
sp|Q6ZQ29|TAOK2_MOUSE Serine/threonine-protein kinase TAO2 OS=Mus musculus GN=Taok2 PE=1 SV=3 1054 1325 4.0E-34
sp|Q6ERS4|CIPKG_ORYSJ CBL-interacting protein kinase 16 OS=Oryza sativa subsp. japonica GN=CIPK16 PE=2 SV=1 1044 1317 4.0E-34
sp|Q9JLS3|TAOK2_RAT Serine/threonine-protein kinase TAO2 OS=Rattus norvegicus GN=Taok2 PE=1 SV=1 1054 1325 5.0E-34
sp|Q54JQ1|MKCC_DICDI Probable serine/threonine-protein kinase mkcC OS=Dictyostelium discoideum GN=mkcC PE=3 SV=1 1054 1317 6.0E-34
sp|Q94C95|ATG1A_ARATH Serine/threonine-protein kinase ATG1a OS=Arabidopsis thaliana GN=ATG1A PE=1 SV=1 1048 1317 8.0E-34
sp|H2L099|GCK1_CAEEL Germinal center kinase 1 OS=Caenorhabditis elegans GN=gck-1 PE=1 SV=1 1054 1317 8.0E-34
sp|Q6NU21|TAO1A_XENLA Serine/threonine-protein kinase TAO1-A OS=Xenopus laevis GN=taok1-a PE=2 SV=1 1054 1325 1.0E-33
sp|Q9UL54|TAOK2_HUMAN Serine/threonine-protein kinase TAO2 OS=Homo sapiens GN=TAOK2 PE=1 SV=2 1054 1325 1.0E-33
sp|Q03497|STE20_YEAST Serine/threonine-protein kinase STE20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STE20 PE=1 SV=1 1054 1320 1.0E-33
sp|Q7TSC3|NEK5_MOUSE Serine/threonine-protein kinase Nek5 OS=Mus musculus GN=Nek5 PE=2 SV=1 1053 1331 1.0E-33
sp|Q3SWY6|STK25_BOVIN Serine/threonine-protein kinase 25 OS=Bos taurus GN=STK25 PE=2 SV=1 1054 1317 1.0E-33
sp|Q5R8Z4|PAK6_PONAB Serine/threonine-protein kinase PAK 6 OS=Pongo abelii GN=PAK6 PE=2 SV=1 1054 1318 3.0E-33
sp|Q8WXR4|MYO3B_HUMAN Myosin-IIIb OS=Homo sapiens GN=MYO3B PE=2 SV=4 1045 1325 3.0E-33
sp|Q9NQU5|PAK6_HUMAN Serine/threonine-protein kinase PAK 6 OS=Homo sapiens GN=PAK6 PE=1 SV=1 1054 1318 3.0E-33
sp|Q8TDX7|NEK7_HUMAN Serine/threonine-protein kinase Nek7 OS=Homo sapiens GN=NEK7 PE=1 SV=1 1054 1306 4.0E-33
sp|Q9P289|STK26_HUMAN Serine/threonine-protein kinase 26 OS=Homo sapiens GN=STK26 PE=1 SV=2 1054 1318 4.0E-33
sp|Q17850|PK1_CAEEL Serine/threonine-protein kinase pak-1 OS=Caenorhabditis elegans GN=pak-1 PE=1 SV=2 1040 1317 4.0E-33
sp|Q54EY4|DST3_DICDI Serine/threonine-protein kinase dst3 OS=Dictyostelium discoideum GN=dst3 PE=3 SV=1 1048 1323 5.0E-33
sp|Q54DC8|Y2350_DICDI Probable serine/threonine-protein kinase DDB_G0292350 OS=Dictyostelium discoideum GN=DDB_G0292350 PE=3 SV=1 1054 1317 5.0E-33
sp|Q99JT2|STK26_MOUSE Serine/threonine-protein kinase 26 OS=Mus musculus GN=Stk26 PE=1 SV=1 1054 1318 5.0E-33
sp|P32562|CDC5_YEAST Cell cycle serine/threonine-protein kinase CDC5/MSD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC5 PE=1 SV=1 1048 1331 5.0E-33
sp|Q9LWM4|CIPK5_ORYSJ CBL-interacting protein kinase 5 OS=Oryza sativa subsp. japonica GN=CIPK5 PE=2 SV=1 1037 1334 6.0E-33
sp|P08458|SPS1_YEAST Sporulation-specific protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPS1 PE=1 SV=2 1054 1320 6.0E-33
sp|Q9ES74|NEK7_MOUSE Serine/threonine-protein kinase Nek7 OS=Mus musculus GN=Nek7 PE=1 SV=1 1054 1306 6.0E-33
sp|Q6CVA2|STE20_KLULA Serine/threonine-protein kinase STE20 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=STE20 PE=3 SV=1 1054 1320 6.0E-33
sp|Q6FN53|STE20_CANGA Serine/threonine-protein kinase STE20 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=STE20 PE=3 SV=1 1054 1320 6.0E-33
sp|O13839|FIN1_SCHPO G2-specific protein kinase fin1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fin1 PE=3 SV=1 1054 1324 6.0E-33
sp|Q9TTK0|CDKL2_RABIT Cyclin-dependent kinase-like 2 OS=Oryctolagus cuniculus GN=CDKL2 PE=2 SV=1 1047 1316 7.0E-33
sp|P46549|SULU_CAEEL Serine/threonine-protein kinase SULU OS=Caenorhabditis elegans GN=kin-18 PE=2 SV=1 1031 1317 8.0E-33
sp|D3ZBE5|NEK7_RAT Serine/threonine-protein kinase Nek7 OS=Rattus norvegicus GN=Nek7 PE=2 SV=1 1054 1306 8.0E-33
sp|P0C8M8|CCR1_MAIZE Probable serine/threonine-protein kinase CCRP1 OS=Zea mays GN=CCRP1 PE=1 SV=1 1047 1317 9.0E-33
sp|P51956|NEK3_HUMAN Serine/threonine-protein kinase Nek3 OS=Homo sapiens GN=NEK3 PE=1 SV=2 1053 1332 9.0E-33
sp|Q93VD3|CIPKN_ARATH CBL-interacting serine/threonine-protein kinase 23 OS=Arabidopsis thaliana GN=CIPK23 PE=1 SV=1 1047 1317 1.0E-32
sp|Q6ZLP5|CIPKN_ORYSJ CBL-interacting protein kinase 23 OS=Oryza sativa subsp. japonica GN=CIPK23 PE=2 SV=1 1047 1317 1.0E-32
sp|Q5QN75|M2K1_ORYSJ Mitogen-activated protein kinase kinase 1 OS=Oryza sativa subsp. japonica GN=MKK1 PE=1 SV=1 1054 1317 1.0E-32
sp|Q54TA3|MRKC_DICDI Probable serine/threonine-protein kinase MARK-C OS=Dictyostelium discoideum GN=mrkC PE=3 SV=1 1048 1316 1.0E-32
sp|Q8WNU8|NEK11_MACFA Serine/threonine-protein kinase Nek11 OS=Macaca fascicularis GN=NEK11 PE=2 SV=1 1033 1317 2.0E-32
sp|Q75DK7|STE20_ASHGO Serine/threonine-protein kinase STE20 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=STE20 PE=3 SV=2 1054 1320 2.0E-32
sp|Q3ULB5|PAK6_MOUSE Serine/threonine-protein kinase PAK 6 OS=Mus musculus GN=Pak6 PE=2 SV=1 1054 1318 2.0E-32
sp|Q8NG66|NEK11_HUMAN Serine/threonine-protein kinase Nek11 OS=Homo sapiens GN=NEK11 PE=1 SV=2 1033 1317 2.0E-32
sp|O64629|AUR3_ARATH Serine/threonine-protein kinase Aurora-3 OS=Arabidopsis thaliana GN=AUR3 PE=2 SV=1 1039 1318 2.0E-32
sp|Q55CE0|MKCF_DICDI Probable serine/threonine-protein kinase mkcF OS=Dictyostelium discoideum GN=mkcF PE=3 SV=1 995 1317 2.0E-32
sp|P70218|M4K1_MOUSE Mitogen-activated protein kinase kinase kinase kinase 1 OS=Mus musculus GN=Map4k1 PE=1 SV=1 1054 1317 3.0E-32
sp|P0CY24|STE20_CANAL Serine/threonine-protein kinase CST20 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CST20 PE=3 SV=1 1054 1317 3.0E-32
sp|Q5AG71|HSL1_CANAL Serine/threonine-protein kinase HSL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HSL1 PE=1 SV=1 1020 1314 3.0E-32
sp|C4YRB7|STE20_CANAW Serine/threonine-protein kinase CST20 OS=Candida albicans (strain WO-1) GN=CST20 PE=3 SV=2 1054 1317 3.0E-32
sp|Q9LP51|CIPKI_ARATH CBL-interacting serine/threonine-protein kinase 18 OS=Arabidopsis thaliana GN=CIPK18 PE=1 SV=1 1020 1317 4.0E-32
sp|Q39030|KPK2_ARATH Serine/threonine-protein kinase AtPK2/AtPK19 OS=Arabidopsis thaliana GN=ATPK2 PE=1 SV=2 1054 1326 4.0E-32
sp|Q55GV3|PAKC_DICDI Serine/threonine-protein kinase pakC OS=Dictyostelium discoideum GN=pakC PE=1 SV=2 1021 1327 4.0E-32
sp|P0CY23|STE20_CANAX Serine/threonine-protein kinase CST20 OS=Candida albicans GN=CST20 PE=3 SV=1 1054 1317 4.0E-32
sp|G5EEN4|GCK3_CAEEL Germinal center kinase 3 OS=Caenorhabditis elegans GN=gck-3 PE=1 SV=1 1054 1317 4.0E-32
sp|Q54MH0|FHKD_DICDI Probable serine/threonine-protein kinase fhkD OS=Dictyostelium discoideum GN=fhkD PE=3 SV=1 1053 1316 4.0E-32
sp|Q9UEW8|STK39_HUMAN STE20/SPS1-related proline-alanine-rich protein kinase OS=Homo sapiens GN=STK39 PE=1 SV=3 1054 1316 5.0E-32
sp|Q55FS2|STK4L_DICDI Serine/threonine-protein kinase 4 homolog B OS=Dictyostelium discoideum GN=krsB PE=3 SV=1 1054 1317 5.0E-32
sp|Q9Z1W9|STK39_MOUSE STE20/SPS1-related proline-alanine-rich protein kinase OS=Mus musculus GN=Stk39 PE=1 SV=1 1053 1316 6.0E-32
sp|Q6H7U5|CIPKQ_ORYSJ CBL-interacting protein kinase 26 OS=Oryza sativa subsp. japonica GN=CIPK26 PE=2 SV=1 1047 1316 6.0E-32
sp|Q54WX4|AURK_DICDI Aurora kinase OS=Dictyostelium discoideum GN=aurK PE=1 SV=1 1051 1317 6.0E-32
sp|Q92772|CDKL2_HUMAN Cyclin-dependent kinase-like 2 OS=Homo sapiens GN=CDKL2 PE=1 SV=1 1047 1317 7.0E-32
sp|P38692|KIC1_YEAST Serine/threonine-protein kinase KIC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIC1 PE=1 SV=1 1043 1319 7.0E-32
sp|O88506|STK39_RAT STE20/SPS1-related proline-alanine-rich protein kinase OS=Rattus norvegicus GN=Stk39 PE=1 SV=2 1053 1316 7.0E-32
sp|P31751|AKT2_HUMAN RAC-beta serine/threonine-protein kinase OS=Homo sapiens GN=AKT2 PE=1 SV=2 1037 1325 7.0E-32
sp|Q7Z8E9|STE20_MAGO7 Serine/threonine-protein kinase MST20 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MST20 PE=3 SV=3 1054 1317 8.0E-32
sp|Q7RZD3|STE20_NEUCR Serine/threonine-protein kinase ste20 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=stk-4 PE=3 SV=1 1054 1317 8.0E-32
sp|Q9LEU7|CIPK5_ARATH CBL-interacting serine/threonine-protein kinase 5 OS=Arabidopsis thaliana GN=CIPK5 PE=2 SV=1 1047 1317 8.0E-32
sp|Q9UKE5|TNIK_HUMAN TRAF2 and NCK-interacting protein kinase OS=Homo sapiens GN=TNIK PE=1 SV=1 1053 1317 8.0E-32
sp|Q9FJ54|CIPKK_ARATH CBL-interacting serine/threonine-protein kinase 20 OS=Arabidopsis thaliana GN=CIPK20 PE=1 SV=1 1044 1330 8.0E-32
sp|P83510|TNIK_MOUSE Traf2 and NCK-interacting protein kinase OS=Mus musculus GN=Tnik PE=1 SV=2 1053 1317 8.0E-32
sp|Q8C015|PAK7_MOUSE Serine/threonine-protein kinase PAK 7 OS=Mus musculus GN=Pak7 PE=1 SV=1 1054 1317 9.0E-32
sp|D4A280|PAK7_RAT Serine/threonine-protein kinase PAK 7 OS=Rattus norvegicus GN=Pak7 PE=1 SV=1 1054 1317 9.0E-32
sp|Q9R0A5|NEK3_MOUSE Serine/threonine-protein kinase Nek3 OS=Mus musculus GN=Nek3 PE=1 SV=2 1054 1312 1.0E-31
sp|Q9FJ55|CIPKJ_ARATH CBL-interacting serine/threonine-protein kinase 19 OS=Arabidopsis thaliana GN=CIPK19 PE=2 SV=1 1047 1317 1.0E-31
sp|Q869N2|PAKB_DICDI Serine/threonine-protein kinase pakB OS=Dictyostelium discoideum GN=pakB PE=1 SV=1 1054 1328 1.0E-31
sp|Q5R754|CDKL2_PONAB Cyclin-dependent kinase-like 2 OS=Pongo abelii GN=CDKL2 PE=2 SV=1 1047 1317 1.0E-31
sp|Q4R7T5|CDKL2_MACFA Cyclin-dependent kinase-like 2 OS=Macaca fascicularis GN=CDKL2 PE=2 SV=1 1047 1317 1.0E-31
sp|P38147|CHK1_YEAST Serine/threonine-protein kinase CHK1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHK1 PE=1 SV=1 1051 1318 2.0E-31
sp|Q0JI49|CIPKB_ORYSJ CBL-interacting protein kinase 11 OS=Oryza sativa subsp. japonica GN=CIPK11 PE=2 SV=1 1047 1340 2.0E-31
sp|Q9STV4|CIPK8_ARATH CBL-interacting serine/threonine-protein kinase 8 OS=Arabidopsis thaliana GN=CIPK8 PE=1 SV=1 1047 1318 2.0E-31
sp|Q9P286|PAK7_HUMAN Serine/threonine-protein kinase PAK 7 OS=Homo sapiens GN=PAK7 PE=1 SV=1 1054 1317 2.0E-31
sp|P92958|KIN11_ARATH SNF1-related protein kinase catalytic subunit alpha KIN11 OS=Arabidopsis thaliana GN=KIN11 PE=1 SV=1 1048 1316 2.0E-31
sp|P92937|CIPKF_ARATH CBL-interacting serine/threonine-protein kinase 15 OS=Arabidopsis thaliana GN=CIPK15 PE=1 SV=2 1037 1317 2.0E-31
sp|Q2VWQ3|STE20_TALMA Serine/threonine-protein kinase pakA OS=Talaromyces marneffei GN=pakA PE=3 SV=1 1045 1317 2.0E-31
sp|P42818|KPK1_ARATH Serine/threonine-protein kinase AtPK1/AtPK6 OS=Arabidopsis thaliana GN=ATPK1 PE=1 SV=1 1054 1335 2.0E-31
sp|Q8N4C8|MINK1_HUMAN Misshapen-like kinase 1 OS=Homo sapiens GN=MINK1 PE=1 SV=2 1053 1317 2.0E-31
sp|Q9LGV5|CIPK1_ORYSJ CBL-interacting protein kinase 1 OS=Oryza sativa subsp. japonica GN=CIPK1 PE=2 SV=1 1047 1317 3.0E-31
sp|Q5XIT0|CDKL2_RAT Cyclin-dependent kinase-like 2 OS=Rattus norvegicus GN=Cdkl2 PE=2 SV=1 1047 1316 3.0E-31
sp|Q55BN8|NEK2_DICDI Probable serine/threonine-protein kinase nek2 OS=Dictyostelium discoideum GN=nek2 PE=1 SV=1 1054 1317 3.0E-31
sp|Q10LQ2|CIPKA_ORYSJ CBL-interacting protein kinase 10 OS=Oryza sativa subsp. japonica GN=CIPK10 PE=2 SV=1 1043 1347 3.0E-31
sp|Q84VQ3|CIPKQ_ARATH CBL-interacting serine/threonine-protein kinase 26 OS=Arabidopsis thaliana GN=CIPK26 PE=1 SV=2 1047 1317 3.0E-31
sp|Q9NGW9|MKCB_DICDI Probable serine/threonine-protein kinase mkcB OS=Dictyostelium discoideum GN=mkcB PE=2 SV=1 1054 1317 3.0E-31
sp|Q8LIG4|CIPK3_ORYSJ CBL-interacting protein kinase 3 OS=Oryza sativa subsp. japonica GN=CIPK3 PE=2 SV=1 1047 1317 4.0E-31
sp|Q6P3R8|NEK5_HUMAN Serine/threonine-protein kinase Nek5 OS=Homo sapiens GN=NEK5 PE=2 SV=1 1054 1332 4.0E-31
sp|Q54B33|PAKE_DICDI Serine/threonine-protein kinase pakE OS=Dictyostelium discoideum GN=pakE PE=3 SV=1 1040 1317 4.0E-31
sp|Q0D4B2|CIPKL_ORYSJ CBL-interacting protein kinase 21 OS=Oryza sativa subsp. japonica GN=CIPK21 PE=2 SV=2 1047 1330 4.0E-31
sp|Q551H4|FRAY2_DICDI Serine/threonine-protein kinase fray2 OS=Dictyostelium discoideum GN=fray2 PE=3 SV=1 1054 1317 5.0E-31
sp|Q5QNM6|CIPKD_ORYSJ Putative CBL-interacting protein kinase 13 OS=Oryza sativa subsp. japonica GN=CIPK13 PE=3 SV=1 1047 1317 5.0E-31
sp|Q2ULU3|STE20_ASPOR Serine/threonine-protein kinase ste20 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ste20 PE=3 SV=1 1054 1317 6.0E-31
sp|Q755C4|IPL1_ASHGO Spindle assembly checkpoint kinase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=IPL1 PE=3 SV=1 1048 1317 6.0E-31
sp|Q76P07|Y7165_DICDI Probable serine/threonine-protein kinase DDB_G0277165 OS=Dictyostelium discoideum GN=DDB_G0277165 PE=3 SV=1 1051 1332 6.0E-31
sp|F1LP90|MINK1_RAT Misshapen-like kinase 1 OS=Rattus norvegicus GN=Mink1 PE=1 SV=2 1053 1317 8.0E-31
sp|Q4WHP3|STE20_ASPFU Serine/threonine-protein kinase ste20 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ste20 PE=3 SV=2 1054 1317 8.0E-31
sp|Q9JM52|MINK1_MOUSE Misshapen-like kinase 1 OS=Mus musculus GN=Mink1 PE=1 SV=3 1053 1317 9.0E-31
sp|Q6DE87|CHK1_XENLA Serine/threonine-protein kinase Chk1 OS=Xenopus laevis GN=chek1 PE=1 SV=2 1048 1325 9.0E-31
sp|Q9QUK0|CDKL2_MOUSE Cyclin-dependent kinase-like 2 OS=Mus musculus GN=Cdkl2 PE=2 SV=1 1047 1317 9.0E-31
sp|Q9SEZ7|CIPKG_ARATH CBL-interacting serine/threonine-protein kinase 16 OS=Arabidopsis thaliana GN=CIPK16 PE=1 SV=1 1040 1317 1.0E-30
sp|Q4KSH7|MP2K7_RAT Dual specificity mitogen-activated protein kinase kinase 7 OS=Rattus norvegicus GN=Map2k7 PE=1 SV=1 1054 1346 1.0E-30
sp|Q6C3J2|IPL1_YARLI Spindle assembly checkpoint kinase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=IPL1 PE=3 SV=1 1048 1321 1.0E-30
sp|Q13163|MP2K5_HUMAN Dual specificity mitogen-activated protein kinase kinase 5 OS=Homo sapiens GN=MAP2K5 PE=1 SV=2 1027 1318 1.0E-30
sp|Q60823|AKT2_MOUSE RAC-beta serine/threonine-protein kinase OS=Mus musculus GN=Akt2 PE=1 SV=1 1053 1325 1.0E-30
sp|O14733|MP2K7_HUMAN Dual specificity mitogen-activated protein kinase kinase 7 OS=Homo sapiens GN=MAP2K7 PE=1 SV=2 1054 1346 1.0E-30
sp|Q2QY53|CIPKW_ORYSJ CBL-interacting protein kinase 32 OS=Oryza sativa subsp. japonica GN=CIPK32 PE=2 SV=2 1040 1317 1.0E-30
sp|P51958|CDK1_CARAU Cyclin-dependent kinase 1 OS=Carassius auratus GN=cdk1 PE=2 SV=1 1054 1317 1.0E-30
sp|P48734|CDK1_BOVIN Cyclin-dependent kinase 1 OS=Bos taurus GN=CDK1 PE=2 SV=2 1054 1324 1.0E-30
sp|Q9FJV0|M2K6_ARATH Mitogen-activated protein kinase kinase 6 OS=Arabidopsis thaliana GN=MKK6 PE=1 SV=1 1054 1317 1.0E-30
sp|G5EGQ3|MAX2_CAEEL Serine/threonine-protein kinase max-2 OS=Caenorhabditis elegans GN=max-2 PE=1 SV=1 1040 1317 1.0E-30
sp|Q6C3D7|STE20_YARLI Serine/threonine-protein kinase STE20 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=STE20 PE=3 SV=1 1054 1318 2.0E-30
sp|P34102|PK3_DICDI Protein kinase 3 OS=Dictyostelium discoideum GN=pkgC PE=3 SV=2 1054 1305 2.0E-30
sp|A8X0C4|PAR4_CAEBR Serine/threonine-protein kinase par-4 OS=Caenorhabditis briggsae GN=par-4 PE=3 SV=2 1051 1317 2.0E-30
sp|O59790|ARK1_SCHPO Serine/threonine-protein kinase ark1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ark1 PE=1 SV=2 1051 1321 2.0E-30
sp|Q4P5N0|STE20_USTMA Serine/threonine-protein kinase SMU1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SMU1 PE=3 SV=1 1054 1330 2.0E-30
sp|O61661|CHK1_DROME Serine/threonine-protein kinase grp OS=Drosophila melanogaster GN=grp PE=1 SV=2 1048 1317 2.0E-30
sp|Q54TN4|MKCE_DICDI Probable serine/threonine-protein kinase mkcE OS=Dictyostelium discoideum GN=mkcE PE=3 SV=1 1057 1317 2.0E-30
sp|Q62862|MP2K5_RAT Dual specificity mitogen-activated protein kinase kinase 5 OS=Rattus norvegicus GN=Map2k5 PE=1 SV=1 1027 1318 2.0E-30
sp|Q8SWM6|CDC5_ENCCU Probable cell cycle serine/threonine-protein kinase CDC5 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=CDC5 PE=3 SV=2 1047 1317 2.0E-30
sp|O22932|CIPKB_ARATH CBL-interacting serine/threonine-protein kinase 11 OS=Arabidopsis thaliana GN=CIPK11 PE=1 SV=1 1047 1318 2.0E-30
sp|Q6BNF3|STE20_DEBHA Serine/threonine-protein kinase STE20 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=STE20 PE=3 SV=2 1054 1318 2.0E-30
sp|P39951|CDK1_RAT Cyclin-dependent kinase 1 OS=Rattus norvegicus GN=Cdk1 PE=1 SV=1 1054 1324 2.0E-30
sp|Q5BBL3|STE20_EMENI Serine/threonine-protein kinase ste20 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ste20 PE=3 SV=1 1054 1317 2.0E-30
sp|Q4FZD7|PLK5_MOUSE Inactive serine/threonine-protein kinase PLK5 OS=Mus musculus GN=Plk5 PE=1 SV=1 1048 1317 3.0E-30
sp|Q54PK9|PDPKB_DICDI 3-phosphoinositide-dependent protein kinase B OS=Dictyostelium discoideum GN=pdkB PE=3 SV=1 1054 1344 3.0E-30
sp|P47197|AKT2_RAT RAC-beta serine/threonine-protein kinase OS=Rattus norvegicus GN=Akt2 PE=1 SV=1 1037 1325 3.0E-30
sp|Q9LDI3|CIPKO_ARATH CBL-interacting serine/threonine-protein kinase 24 OS=Arabidopsis thaliana GN=CIPK24 PE=1 SV=1 1047 1263 3.0E-30
sp|Q54MY9|MKCA_DICDI Probable serine/threonine-protein kinase mkcA OS=Dictyostelium discoideum GN=mkcA PE=2 SV=1 1054 1317 3.0E-30
sp|Q9WVS7|MP2K5_MOUSE Dual specificity mitogen-activated protein kinase kinase 5 OS=Mus musculus GN=Map2k5 PE=1 SV=1 1027 1318 4.0E-30
sp|Q38997|KIN10_ARATH SNF1-related protein kinase catalytic subunit alpha KIN10 OS=Arabidopsis thaliana GN=KIN10 PE=1 SV=2 1039 1319 4.0E-30
sp|P34244|HSL1_YEAST Probable serine/threonine-protein kinase HSL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HSL1 PE=1 SV=2 1020 1317 4.0E-30
sp|Q2V452|CIPK3_ARATH CBL-interacting serine/threonine-protein kinase 3 OS=Arabidopsis thaliana GN=CIPK3 PE=1 SV=2 1047 1317 5.0E-30
sp|Q2RAX3|CIPKX_ORYSJ CBL-interacting protein kinase 33 OS=Oryza sativa subsp. japonica GN=CIPK33 PE=2 SV=1 1047 1317 6.0E-30
sp|Q8SSV3|MKCD_DICDI Probable serine/threonine-protein kinase mkcD OS=Dictyostelium discoideum GN=mkcD PE=3 SV=1 1053 1317 6.0E-30
sp|Q68Y49|CIPKJ_ORYSJ CBL-interacting protein kinase 19 OS=Oryza sativa subsp. japonica GN=CIPK19 PE=1 SV=1 1047 1317 6.0E-30
sp|Q9U1Y5|CHK2_CAEEL Serine/threonine-protein kinase chk-2 OS=Caenorhabditis elegans GN=chk-2 PE=2 SV=2 1052 1317 7.0E-30
sp|Q8CE90|MP2K7_MOUSE Dual specificity mitogen-activated protein kinase kinase 7 OS=Mus musculus GN=Map2k7 PE=1 SV=1 1054 1317 7.0E-30
sp|Q54XL6|FRAY1_DICDI Serine/threonine-protein kinase fray1 OS=Dictyostelium discoideum GN=fray1 PE=3 SV=1 1054 1315 7.0E-30
sp|A1A5Q6|SMK_RAT Sperm motility kinase OS=Rattus norvegicus GN=Smok PE=2 SV=1 1054 1358 7.0E-30
sp|P06493|CDK1_HUMAN Cyclin-dependent kinase 1 OS=Homo sapiens GN=CDK1 PE=1 SV=3 1054 1324 8.0E-30
sp|Q9DGD3|CDK1_ORYLA Cyclin-dependent kinase 1 OS=Oryzias latipes GN=cdk1 PE=2 SV=1 1054 1317 8.0E-30
sp|Q5JLD8|CIPK8_ORYSJ CBL-interacting protein kinase 8 OS=Oryza sativa subsp. japonica GN=CIPK8 PE=2 SV=1 1047 1317 9.0E-30
sp|P49673|KAPC_ASCSU cAMP-dependent protein kinase catalytic subunit OS=Ascaris suum GN=CAPK PE=2 SV=1 1054 1320 9.0E-30
sp|Q3U3Q1|ULK3_MOUSE Serine/threonine-protein kinase ULK3 OS=Mus musculus GN=Ulk3 PE=2 SV=1 1054 1317 9.0E-30
sp|Q5W736|CIPKI_ORYSJ CBL-interacting protein kinase 18 OS=Oryza sativa subsp. japonica GN=CIPK18 PE=2 SV=1 1037 1317 1.0E-29
sp|Q9DGA2|CDK1_ORYJA Cyclin-dependent kinase 1 OS=Oryzias javanicus GN=cdk1 PE=2 SV=1 1054 1317 1.0E-29
sp|Q9C562|CIPKA_ARATH CBL-interacting serine/threonine-protein kinase 10 OS=Arabidopsis thaliana GN=CIPK10 PE=1 SV=1 1044 1361 1.0E-29
sp|Q9DG98|CDK1_ORYLU Cyclin-dependent kinase 1 OS=Oryzias luzonensis GN=cdk1 PE=2 SV=1 1054 1317 1.0E-29
sp|P11440|CDK1_MOUSE Cyclin-dependent kinase 1 OS=Mus musculus GN=Cdk1 PE=1 SV=3 1054 1324 1.0E-29
sp|Q4V7Q6|ULK3_XENLA Serine/threonine-protein kinase ULK3 OS=Xenopus laevis GN=ulk3 PE=2 SV=1 1054 1317 1.0E-29
sp|Q01314|AKT1_BOVIN RAC-alpha serine/threonine-protein kinase OS=Bos taurus GN=AKT1 PE=1 SV=2 987 1325 1.0E-29
sp|P25389|KCC4_YEAST Probable serine/threonine-protein kinase KCC4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KCC4 PE=1 SV=3 1048 1317 1.0E-29
sp|Q8AYC9|CHK1_CHICK Serine/threonine-protein kinase Chk1 OS=Gallus gallus GN=CHEK1 PE=1 SV=1 1048 1316 1.0E-29
sp|O22971|CIPKD_ARATH CBL-interacting serine/threonine-protein kinase 13 OS=Arabidopsis thaliana GN=CIPK13 PE=1 SV=2 1047 1316 1.0E-29
sp|O95819|M4K4_HUMAN Mitogen-activated protein kinase kinase kinase kinase 4 OS=Homo sapiens GN=MAP4K4 PE=1 SV=2 1054 1317 1.0E-29
sp|Q98TY9|AKT1_XENLA RAC-alpha serine/threonine-protein kinase OS=Xenopus laevis GN=akt1 PE=2 SV=1 987 1325 1.0E-29
sp|F4J6F6|IREH1_ARATH Probable serine/threonine protein kinase IREH1 OS=Arabidopsis thaliana GN=IREH1 PE=1 SV=1 1054 1314 1.0E-29
sp|Q9MAM1|CIPK9_ARATH CBL-interacting serine/threonine-protein kinase 9 OS=Arabidopsis thaliana GN=CIPK9 PE=1 SV=2 1048 1317 1.0E-29
sp|Q9DGA5|CDK1_ORYCU Cyclin-dependent kinase 1 OS=Oryzias curvinotus GN=cdk1 PE=2 SV=1 1054 1317 1.0E-29
sp|Q9Z1J2|NEK4_MOUSE Serine/threonine-protein kinase Nek4 OS=Mus musculus GN=Nek4 PE=1 SV=1 1053 1317 2.0E-29
sp|P32491|MKK2_YEAST MAP kinase kinase MKK2/SSP33 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MKK2 PE=1 SV=2 1048 1319 2.0E-29
sp|O14098|CTK1_SCHPO CTD kinase subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lsk1 PE=1 SV=1 1054 1328 2.0E-29
sp|O75011|NAK1_SCHPO Serine/threonine-protein kinase nak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nak1 PE=1 SV=1 1053 1317 2.0E-29
sp|P35567|CDK1A_XENLA Cyclin-dependent kinase 1-A OS=Xenopus laevis GN=cdk1-a PE=1 SV=1 1054 1316 2.0E-29
sp|A3B529|CIPKS_ORYSJ CBL-interacting protein kinase 28 OS=Oryza sativa subsp. japonica GN=CIPK28 PE=2 SV=2 1047 1316 2.0E-29
sp|Q75L42|CIPKH_ORYSJ CBL-interacting protein kinase 17 OS=Oryza sativa subsp. japonica GN=CIPK17 PE=2 SV=1 1048 1317 2.0E-29
sp|Q5RCH1|CDK1_PONAB Cyclin-dependent kinase 1 OS=Pongo abelii GN=CDK1 PE=2 SV=1 1054 1324 2.0E-29
sp|F4JBP3|ATG1B_ARATH Serine/threonine-protein kinase ATG1b OS=Arabidopsis thaliana GN=ATG1B PE=2 SV=1 1030 1317 3.0E-29
sp|Q9C098|DCLK3_HUMAN Serine/threonine-protein kinase DCLK3 OS=Homo sapiens GN=DCLK3 PE=2 SV=2 995 1317 3.0E-29
sp|Q8MYF1|Y2070_DICDI Probable serine/threonine-protein kinase DDB_G0277449 OS=Dictyostelium discoideum GN=DDB_G0277449 PE=3 SV=1 1052 1331 3.0E-29
sp|F4HPN2|IRE4_ARATH Probable serine/threonine protein kinase IRE4 OS=Arabidopsis thaliana GN=IRE4 PE=2 SV=1 1054 1308 4.0E-29
sp|Q7YRC6|AURKB_BOVIN Aurora kinase B OS=Bos taurus GN=AURKB PE=2 SV=1 1038 1330 4.0E-29
sp|Q91820|AURAA_XENLA Aurora kinase A-A OS=Xenopus laevis GN=aurka-a PE=1 SV=1 1051 1318 4.0E-29
sp|Q8W1D5|CIPKP_ARATH CBL-interacting serine/threonine-protein kinase 25 OS=Arabidopsis thaliana GN=CIPK25 PE=2 SV=1 1047 1317 4.0E-29
sp|Q5ZJH6|ULK3_CHICK Serine/threonine-protein kinase ULK3 OS=Gallus gallus GN=ULK3 PE=2 SV=1 1054 1317 4.0E-29
sp|Q6ERS0|CIPKR_ORYSJ Putative CBL-interacting protein kinase 27 OS=Oryza sativa subsp. japonica GN=CIPK27 PE=3 SV=1 1047 1337 4.0E-29
sp|P31749|AKT1_HUMAN RAC-alpha serine/threonine-protein kinase OS=Homo sapiens GN=AKT1 PE=1 SV=2 987 1325 4.0E-29
sp|Q7X996|CIPK2_ORYSJ CBL-interacting protein kinase 2 OS=Oryza sativa subsp. japonica GN=CIPK2 PE=2 SV=1 1047 1317 4.0E-29
sp|G5EFM9|NEKL3_CAEEL Serine/threonine-protein kinase nekl-3 OS=Caenorhabditis elegans GN=nekl-3 PE=1 SV=1 1054 1313 5.0E-29
sp|O60285|NUAK1_HUMAN NUAK family SNF1-like kinase 1 OS=Homo sapiens GN=NUAK1 PE=1 SV=1 1043 1317 5.0E-29
sp|Q7Z2Y5|NRK_HUMAN Nik-related protein kinase OS=Homo sapiens GN=NRK PE=1 SV=2 1054 1329 6.0E-29
sp|Q9NRP7|STK36_HUMAN Serine/threonine-protein kinase 36 OS=Homo sapiens GN=STK36 PE=1 SV=2 1053 1334 6.0E-29
sp|P22216|RAD53_YEAST Serine/threonine-protein kinase RAD53 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD53 PE=1 SV=1 1054 1317 6.0E-29
sp|Q23356|MIG15_CAEEL Serine/threonine-protein kinase mig-15 OS=Caenorhabditis elegans GN=mig-15 PE=2 SV=3 1054 1317 6.0E-29
sp|Q6PHR2|ULK3_HUMAN Serine/threonine-protein kinase ULK3 OS=Homo sapiens GN=ULK3 PE=1 SV=2 1054 1317 6.0E-29
sp|Q54LH8|Y6627_DICDI Probable serine/threonine-protein kinase DDB_G0286627 OS=Dictyostelium discoideum GN=DDB_G0286627 PE=3 SV=1 1028 1317 6.0E-29
sp|Q5APR8|CLA4_CANAL Serine/threonine-protein kinase CLA4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CLA4 PE=1 SV=1 1055 1317 7.0E-29
sp|O14427|CLA4_CANAX Serine/threonine-protein kinase CLA4 OS=Candida albicans GN=CLA4 PE=3 SV=1 1055 1317 7.0E-29
sp|Q4V3C8|PDPK2_ARATH 3-phosphoinositide-dependent protein kinase 2 OS=Arabidopsis thaliana GN=PDPK2 PE=1 SV=1 1032 1308 7.0E-29
sp|Q9W739|CDK1_RANDY Cyclin-dependent kinase 1 OS=Rana dybowskii GN=CDK1 PE=2 SV=1 1054 1316 7.0E-29
sp|Q9R012|PLK2_RAT Serine/threonine-protein kinase PLK2 OS=Rattus norvegicus GN=Plk2 PE=1 SV=1 1047 1318 7.0E-29
sp|P51954|NEK1_MOUSE Serine/threonine-protein kinase Nek1 OS=Mus musculus GN=Nek1 PE=1 SV=2 1054 1317 8.0E-29
sp|Q9NYY3|PLK2_HUMAN Serine/threonine-protein kinase PLK2 OS=Homo sapiens GN=PLK2 PE=1 SV=3 1047 1318 8.0E-29
sp|Q5R4L1|PLK2_PONAB Serine/threonine-protein kinase PLK2 OS=Pongo abelii GN=PLK2 PE=3 SV=1 1047 1318 8.0E-29
sp|P51817|PRKX_HUMAN cAMP-dependent protein kinase catalytic subunit PRKX OS=Homo sapiens GN=PRKX PE=1 SV=1 1054 1325 9.0E-29
sp|Q9N0X0|AURKB_PIG Aurora kinase B OS=Sus scrofa GN=AURKB PE=2 SV=2 1038 1330 9.0E-29
sp|P27466|KCC1_YEAST Calcium/calmodulin-dependent protein kinase I OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CMK1 PE=1 SV=2 1025 1319 9.0E-29
sp|O80396|M2K3_ARATH Mitogen-activated protein kinase kinase 3 OS=Arabidopsis thaliana GN=MKK3 PE=1 SV=1 1054 1329 1.0E-28
sp|A8XQD5|DKF2_CAEBR Serine/threonine-protein kinase dkf-2 OS=Caenorhabditis briggsae GN=dkf-2 PE=3 SV=2 1054 1317 1.0E-28
sp|P50528|PLO1_SCHPO Serine/threonine-protein kinase plo1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=plo1 PE=1 SV=1 1059 1366 1.0E-28
sp|P13863|CDK1_CHICK Cyclin-dependent kinase 1 OS=Gallus gallus GN=CDK1 PE=1 SV=1 1054 1316 1.0E-28
sp|P23572|CDK1_DROME Cyclin-dependent kinase 1 OS=Drosophila melanogaster GN=Cdk1 PE=1 SV=1 1054 1325 1.0E-28
sp|Q10SC8|CIPK9_ORYSJ CBL-interacting protein kinase 9 OS=Oryza sativa subsp. japonica GN=CIPK9 PE=2 SV=1 1047 1317 1.0E-28
sp|Q66HE7|CDKL1_RAT Cyclin-dependent kinase-like 1 OS=Rattus norvegicus GN=Cdkl1 PE=2 SV=1 1054 1332 1.0E-28
sp|Q91819|AURAB_XENLA Aurora kinase A-B OS=Xenopus laevis GN=aurka-b PE=2 SV=3 1051 1334 1.0E-28
sp|P51957|NEK4_HUMAN Serine/threonine-protein kinase Nek4 OS=Homo sapiens GN=NEK4 PE=1 SV=2 1053 1346 1.0E-28
sp|P46551|CDK12_CAEEL Cyclin-dependent kinase 12 OS=Caenorhabditis elegans GN=cdk-12 PE=1 SV=4 1026 1327 1.0E-28
sp|Q90XC2|NEK8_DANRE Serine/threonine-protein kinase Nek8 OS=Danio rerio GN=nek8 PE=2 SV=1 1047 1314 1.0E-28
sp|P53351|PLK2_MOUSE Serine/threonine-protein kinase PLK2 OS=Mus musculus GN=Plk2 PE=1 SV=1 1047 1318 1.0E-28
sp|Q9M077|AUR1_ARATH Serine/threonine-protein kinase Aurora-1 OS=Arabidopsis thaliana GN=AUR1 PE=1 SV=1 1047 1318 1.0E-28
sp|Q7ZX15|AKT2A_XENLA RAC-beta serine/threonine-protein kinase A OS=Xenopus laevis GN=akt2-a PE=2 SV=1 1037 1325 1.0E-28
sp|F4IRW0|ATG1C_ARATH Serine/threonine-protein kinase ATG1c OS=Arabidopsis thaliana GN=ATG1C PE=2 SV=1 1051 1317 1.0E-28
sp|Q6X4A2|CIPKV_ORYSJ CBL-interacting protein kinase 31 OS=Oryza sativa subsp. japonica GN=CIPK31 PE=1 SV=1 1035 1317 1.0E-28
sp|D3ZHP7|ULK3_RAT Serine/threonine-protein kinase ULK3 OS=Rattus norvegicus GN=Ulk3 PE=1 SV=1 1054 1317 2.0E-28
sp|Q8TD19|NEK9_HUMAN Serine/threonine-protein kinase Nek9 OS=Homo sapiens GN=NEK9 PE=1 SV=2 1054 1346 2.0E-28
sp|Q5JLQ9|CIPKU_ORYSJ CBL-interacting protein kinase 30 OS=Oryza sativa subsp. japonica GN=CIPK30 PE=2 SV=1 1038 1317 2.0E-28
sp|Q5RAJ5|STK36_PONAB Serine/threonine-protein kinase 36 OS=Pongo abelii GN=STK36 PE=2 SV=1 1053 1334 2.0E-28
sp|P28178|PK2_DICDI Protein kinase 2 OS=Dictyostelium discoideum GN=pkgB PE=1 SV=2 1052 1320 2.0E-28
sp|Q9XF67|PDPK1_ARATH 3-phosphoinositide-dependent protein kinase 1 OS=Arabidopsis thaliana GN=PDPK1 PE=1 SV=1 1027 1337 2.0E-28
sp|Q8C0Q4|NEK11_MOUSE Serine/threonine-protein kinase Nek11 OS=Mus musculus GN=Nek11 PE=2 SV=2 1044 1317 2.0E-28
sp|Q8INB9|AKT1_DROME RAC serine/threonine-protein kinase OS=Drosophila melanogaster GN=Akt1 PE=1 SV=3 1054 1305 2.0E-28
sp|Q95ZQ4|AAPK2_CAEEL 5'-AMP-activated protein kinase catalytic subunit alpha-2 OS=Caenorhabditis elegans GN=aak-2 PE=1 SV=2 1051 1317 2.0E-28
sp|Q91ZN7|CHK1_RAT Serine/threonine-protein kinase Chk1 OS=Rattus norvegicus GN=Chek1 PE=2 SV=1 1048 1316 2.0E-28
sp|Q9ES70|NEK6_MOUSE Serine/threonine-protein kinase Nek6 OS=Mus musculus GN=Nek6 PE=1 SV=1 1054 1316 3.0E-28
sp|G5EFU0|PK2_CAEEL Serine/threonine-protein kinase pak-2 OS=Caenorhabditis elegans GN=pak-2 PE=2 SV=1 1054 1317 3.0E-28
sp|P34099|KAPC_DICDI cAMP-dependent protein kinase catalytic subunit OS=Dictyostelium discoideum GN=pkaC PE=1 SV=2 1048 1320 3.0E-28
sp|A4IGM9|AURKB_XENTR Aurora kinase B OS=Xenopus tropicalis GN=aurkb PE=2 SV=1 1051 1328 3.0E-28
sp|Q2TA06|AURKA_BOVIN Aurora kinase A OS=Bos taurus GN=AURKA PE=2 SV=1 1051 1319 3.0E-28
sp|O65554|CIPK6_ARATH CBL-interacting serine/threonine-protein kinase 6 OS=Arabidopsis thaliana GN=CIPK6 PE=1 SV=1 1047 1317 3.0E-28
sp|Q9Z265|CHK2_MOUSE Serine/threonine-protein kinase Chk2 OS=Mus musculus GN=Chek2 PE=1 SV=1 1054 1317 3.0E-28
sp|P32490|MKK1_YEAST MAP kinase kinase MKK1/SSP32 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MKK1 PE=1 SV=1 1043 1317 3.0E-28
sp|Q69ZM6|STK36_MOUSE Serine/threonine-protein kinase 36 OS=Mus musculus GN=Stk36 PE=1 SV=3 1053 1334 3.0E-28
sp|P23437|CDK2_XENLA Cyclin-dependent kinase 2 OS=Xenopus laevis GN=cdk2 PE=1 SV=3 1048 1327 4.0E-28
sp|Q9HC98|NEK6_HUMAN Serine/threonine-protein kinase Nek6 OS=Homo sapiens GN=NEK6 PE=1 SV=2 1054 1306 4.0E-28
sp|Q683C9|AUR2_ARATH Serine/threonine-protein kinase Aurora-2 OS=Arabidopsis thaliana GN=AUR2 PE=2 SV=2 1047 1318 4.0E-28
sp|P34208|CHK1_SCHPO Serine/threonine-protein kinase chk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=chk1 PE=1 SV=2 1048 1317 4.0E-28
sp|Q8RWC9|CIPK1_ARATH CBL-interacting serine/threonine-protein kinase 1 OS=Arabidopsis thaliana GN=CIPK1 PE=1 SV=2 1047 1316 4.0E-28
sp|P47809|MP2K4_MOUSE Dual specificity mitogen-activated protein kinase kinase 4 OS=Mus musculus GN=Map2k4 PE=1 SV=2 1054 1331 4.0E-28
sp|Q9Y243|AKT3_HUMAN RAC-gamma serine/threonine-protein kinase OS=Homo sapiens GN=AKT3 PE=1 SV=1 1000 1325 4.0E-28
sp|Q69Q47|CIPKO_ORYSJ CBL-interacting protein kinase 24 OS=Oryza sativa subsp. japonica GN=CIPK24 PE=1 SV=1 1047 1316 4.0E-28
sp|Q9LQM8|M2K10_ARATH Mitogen-activated protein kinase kinase 10 OS=Arabidopsis thaliana GN=MKK10 PE=1 SV=1 1054 1317 4.0E-28
sp|Q2RBF0|CIPKF_ORYSJ CBL-interacting protein kinase 15 OS=Oryza sativa subsp. japonica GN=CIPK15 PE=2 SV=1 1047 1259 4.0E-28
sp|Q12706|PSK1_SCHPO Serine/threonine-protein kinase psk1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psk1 PE=3 SV=1 1054 1308 4.0E-28
sp|Q59W62|GIN4_CANAL Serine/threonine-protein kinase GIN4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GIN4 PE=1 SV=1 1048 1317 4.0E-28
sp|Q9QYZ5|SMK3_MOUSE Sperm motility kinase 3 OS=Mus musculus GN=Smok3a PE=2 SV=1 1054 1317 4.0E-28
sp|Q6GPL3|AUKBB_XENLA Aurora kinase B-B OS=Xenopus laevis GN=aurkb-b PE=2 SV=1 995 1328 5.0E-28
sp|Q6BRY2|PHO85_DEBHA Negative regulator of the PHO system OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PHO85 PE=3 SV=2 1042 1320 5.0E-28
sp|P31750|AKT1_MOUSE RAC-alpha serine/threonine-protein kinase OS=Mus musculus GN=Akt1 PE=1 SV=2 1027 1325 5.0E-28
sp|Q9LPQ3|M2K7_ARATH Mitogen-activated protein kinase kinase 7 OS=Arabidopsis thaliana GN=MKK7 PE=1 SV=1 1052 1317 5.0E-28
sp|Q9WUA6|AKT3_MOUSE RAC-gamma serine/threonine-protein kinase OS=Mus musculus GN=Akt3 PE=1 SV=1 987 1325 5.0E-28
sp|Q5Z6X0|CIPKP_ORYSJ CBL-interacting protein kinase 25 OS=Oryza sativa subsp. japonica GN=CIPK25 PE=2 SV=1 1045 1317 5.0E-28
sp|Q86I06|NEK3_DICDI Probable serine/threonine-protein kinase nek3 OS=Dictyostelium discoideum GN=nek3 PE=3 SV=1 1047 1317 5.0E-28
sp|P47196|AKT1_RAT RAC-alpha serine/threonine-protein kinase OS=Rattus norvegicus GN=Akt1 PE=1 SV=1 987 1325 5.0E-28
sp|Q96PY6|NEK1_HUMAN Serine/threonine-protein kinase Nek1 OS=Homo sapiens GN=NEK1 PE=1 SV=2 1054 1317 5.0E-28
sp|P24033|CDK1B_XENLA Cyclin-dependent kinase 1-B OS=Xenopus laevis GN=cdk1-b PE=1 SV=2 1054 1316 6.0E-28
sp|Q63796|M3K12_RAT Mitogen-activated protein kinase kinase kinase 12 OS=Rattus norvegicus GN=Map3k12 PE=1 SV=1 1053 1314 6.0E-28
sp|P06245|KAPB_YEAST cAMP-dependent protein kinase type 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK2 PE=1 SV=2 1054 1347 6.0E-28
sp|P05986|KAPC_YEAST cAMP-dependent protein kinase type 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPK3 PE=1 SV=2 1034 1305 6.0E-28
sp|Q6IP76|AKT2B_XENLA RAC-beta serine/threonine-protein kinase B OS=Xenopus laevis GN=akt2-b PE=2 SV=1 1037 1325 6.0E-28
sp|Q2QYM3|CIPKE_ORYSJ CBL-interacting protein kinase 14 OS=Oryza sativa subsp. japonica GN=CIPK14 PE=2 SV=1 1047 1259 6.0E-28
sp|P31748|AKT_MLVAT AKT kinase-transforming protein OS=AKT8 murine leukemia virus GN=V-AKT PE=1 SV=1 1027 1325 7.0E-28
sp|Q13131|AAPK1_HUMAN 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Homo sapiens GN=PRKAA1 PE=1 SV=4 1047 1334 7.0E-28
sp|Q60806|PLK3_MOUSE Serine/threonine-protein kinase PLK3 OS=Mus musculus GN=Plk3 PE=1 SV=2 1048 1317 7.0E-28
sp|A2BD05|NEK6_PIG Serine/threonine-protein kinase Nek6 OS=Sus scrofa GN=NEK6 PE=3 SV=1 1054 1306 7.0E-28
sp|Q641K5|NUAK1_MOUSE NUAK family SNF1-like kinase 1 OS=Mus musculus GN=Nuak1 PE=1 SV=1 1043 1317 8.0E-28
sp|Q6DE08|AUKBA_XENLA Aurora kinase B-A OS=Xenopus laevis GN=aurkb-a PE=1 SV=1 1051 1334 8.0E-28
sp|P54645|AAPK1_RAT 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Rattus norvegicus GN=Prkaa1 PE=1 SV=2 1047 1334 8.0E-28
sp|O35280|CHK1_MOUSE Serine/threonine-protein kinase Chk1 OS=Mus musculus GN=Chek1 PE=1 SV=2 1048 1259 8.0E-28
sp|Q61846|MELK_MOUSE Maternal embryonic leucine zipper kinase OS=Mus musculus GN=Melk PE=1 SV=2 1054 1326 9.0E-28
sp|P45985|MP2K4_HUMAN Dual specificity mitogen-activated protein kinase kinase 4 OS=Homo sapiens GN=MAP2K4 PE=1 SV=1 1054 1331 9.0E-28
sp|Q5EG47|AAPK1_MOUSE 5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Mus musculus GN=Prkaa1 PE=1 SV=2 1047 1334 9.0E-28
sp|P97477|AURKA_MOUSE Aurora kinase A OS=Mus musculus GN=Aurka PE=1 SV=1 1026 1340 9.0E-28
sp|O14757|CHK1_HUMAN Serine/threonine-protein kinase Chk1 OS=Homo sapiens GN=CHEK1 PE=1 SV=2 1048 1316 9.0E-28
sp|Q5RDH5|AAPK1_PONAB 5'-AMP-activated protein kinase catalytic subunit alpha-1 (Fragment) OS=Pongo abelii GN=PRKAA1 PE=2 SV=2 1047 1334 1.0E-27
sp|Q7XJR9|CDPKG_ARATH Calcium-dependent protein kinase 16 OS=Arabidopsis thaliana GN=CPK16 PE=3 SV=1 1041 1317 1.0E-27
sp|Q6Z9F4|CIPK6_ORYSJ CBL-interacting protein kinase 6 OS=Oryza sativa subsp. japonica GN=CIPK6 PE=2 SV=1 1042 1317 1.0E-27
sp|Q6CWQ4|IPL1_KLULA Spindle assembly checkpoint kinase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=IPL1 PE=3 SV=1 1043 1317 1.0E-27
sp|Q922R0|PRKX_MOUSE cAMP-dependent protein kinase catalytic subunit PRKX OS=Mus musculus GN=Prkx PE=1 SV=1 1038 1325 1.0E-27
sp|O43293|DAPK3_HUMAN Death-associated protein kinase 3 OS=Homo sapiens GN=DAPK3 PE=1 SV=1 1043 1325 1.0E-27
sp|P59895|NEK6_RAT Serine/threonine-protein kinase Nek6 OS=Rattus norvegicus GN=Nek6 PE=1 SV=1 1054 1306 1.0E-27
sp|Q5JLS2|CIPKC_ORYSJ CBL-interacting protein kinase 12 OS=Oryza sativa subsp. japonica GN=CIPK12 PE=1 SV=1 1043 1317 1.0E-27
sp|Q54WW7|Y0010_DICDI Probable serine/threonine-protein kinase DDB_G0279405 OS=Dictyostelium discoideum GN=DDB_G0279405 PE=3 SV=1 1054 1316 1.0E-27
sp|O14965|AURKA_HUMAN Aurora kinase A OS=Homo sapiens GN=AURKA PE=1 SV=2 1051 1323 1.0E-27
sp|Q9H4B4|PLK3_HUMAN Serine/threonine-protein kinase PLK3 OS=Homo sapiens GN=PLK3 PE=1 SV=2 1048 1317 1.0E-27
sp|Q8CEQ0|CDKL1_MOUSE Cyclin-dependent kinase-like 1 OS=Mus musculus GN=Cdkl1 PE=2 SV=1 1054 1321 1.0E-27
sp|Q9SCS2|CAMK5_ARATH CDPK-related kinase 5 OS=Arabidopsis thaliana GN=CRK5 PE=2 SV=1 1031 1317 1.0E-27
sp|O88866|HUNK_MOUSE Hormonally up-regulated neu tumor-associated kinase OS=Mus musculus GN=Hunk PE=2 SV=1 1054 1317 2.0E-27
sp|U4PR86|MELK_CAEEL Maternal embryonic leucine zipper kinase OS=Caenorhabditis elegans GN=pig-1 PE=1 SV=1 1054 1317 2.0E-27
sp|A5GFW1|AURKA_PIG Aurora kinase A OS=Sus scrofa GN=AURKA PE=3 SV=1 1051 1319 2.0E-27
sp|Q55GU0|Y9955_DICDI Probable serine/threonine-protein kinase DDB_G0267514 OS=Dictyostelium discoideum GN=DDB_G0267514 PE=3 SV=1 1054 1313 2.0E-27
sp|Q9LE81|IRE_ARATH Probable serine/threonine protein kinase IRE OS=Arabidopsis thaliana GN=IRE PE=2 SV=1 889 1320 2.0E-27
sp|O45818|DKF2_CAEEL Serine/threonine-protein kinase dkf-2 OS=Caenorhabditis elegans GN=dkf-2 PE=1 SV=4 1054 1317 2.0E-27
sp|Q8SRL5|IPL1_ENCCU Probable spindle assembly checkpoint kinase homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=IPL1 PE=3 SV=1 1047 1318 2.0E-27
sp|Q6BVA0|IPL1_DEBHA Spindle assembly checkpoint kinase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=IPL1 PE=3 SV=2 1034 1318 2.0E-27
sp|Q63484|AKT3_RAT RAC-gamma serine/threonine-protein kinase OS=Rattus norvegicus GN=Akt3 PE=2 SV=2 1000 1325 2.0E-27
sp|Q8BLF2|CDKL3_MOUSE Cyclin-dependent kinase-like 3 OS=Mus musculus GN=Cdkl3 PE=2 SV=2 1054 1330 2.0E-27
sp|P29678|MP2K1_RABIT Dual specificity mitogen-activated protein kinase kinase 1 OS=Oryctolagus cuniculus GN=MAP2K1 PE=1 SV=2 1054 1335 2.0E-27
sp|Q07192|MP2K2_XENLA Dual specificity mitogen-activated protein kinase kinase 2 (Fragment) OS=Xenopus laevis GN=map2k2 PE=1 SV=1 1054 1328 3.0E-27
sp|O43930|PRKY_HUMAN Putative serine/threonine-protein kinase PRKY OS=Homo sapiens GN=PRKY PE=5 SV=1 1054 1276 3.0E-27
sp|P80192|M3K9_HUMAN Mitogen-activated protein kinase kinase kinase 9 OS=Homo sapiens GN=MAP3K9 PE=1 SV=3 1053 1312 3.0E-27
sp|O96017|CHK2_HUMAN Serine/threonine-protein kinase Chk2 OS=Homo sapiens GN=CHEK2 PE=1 SV=1 1054 1317 3.0E-27
sp|Q3U1V8|M3K9_MOUSE Mitogen-activated protein kinase kinase kinase 9 OS=Mus musculus GN=Map3k9 PE=2 SV=2 1053 1312 4.0E-27
sp|Q9R0G8|NRK_MOUSE Nik-related protein kinase OS=Mus musculus GN=Nrk PE=1 SV=2 1054 1329 4.0E-27
sp|Q02750|MP2K1_HUMAN Dual specificity mitogen-activated protein kinase kinase 1 OS=Homo sapiens GN=MAP2K1 PE=1 SV=2 1054 1335 4.0E-27
sp|Q00532|CDKL1_HUMAN Cyclin-dependent kinase-like 1 OS=Homo sapiens GN=CDKL1 PE=1 SV=5 1054 1321 4.0E-27
sp|Q8W490|PEPK2_ARATH Serine/threonine-protein kinase PEPKR2 OS=Arabidopsis thaliana GN=PEPKR2 PE=2 SV=1 1051 1318 4.0E-27
sp|Q12852|M3K12_HUMAN Mitogen-activated protein kinase kinase kinase 12 OS=Homo sapiens GN=MAP3K12 PE=1 SV=2 1053 1314 5.0E-27
sp|Q9LT35|NEK6_ARATH Serine/threonine-protein kinase Nek6 OS=Arabidopsis thaliana GN=NEK6 PE=3 SV=1 1054 1314 5.0E-27
sp|Q60700|M3K12_MOUSE Mitogen-activated protein kinase kinase kinase 12 OS=Mus musculus GN=Map3k12 PE=1 SV=1 1053 1314 5.0E-27
sp|Q9QYZ3|SMK2B_MOUSE Sperm motility kinase 2B OS=Mus musculus GN=Smok2b PE=2 SV=1 1054 1317 5.0E-27
sp|O70126|AURKB_MOUSE Aurora kinase B OS=Mus musculus GN=Aurkb PE=1 SV=2 1051 1328 5.0E-27
sp|P59241|AURKA_RAT Aurora kinase A OS=Rattus norvegicus GN=Aurka PE=1 SV=1 1051 1340 6.0E-27
sp|F4HYG2|IRE3_ARATH Probable serine/threonine protein kinase IRE3 OS=Arabidopsis thaliana GN=IRE3 PE=2 SV=1 1054 1320 6.0E-27
sp|Q8BWQ5|DCLK3_MOUSE Serine/threonine-protein kinase DCLK3 OS=Mus musculus GN=Dclk3 PE=2 SV=2 1041 1317 6.0E-27
sp|Q94CG0|CIPKL_ARATH CBL-interacting serine/threonine-protein kinase 21 OS=Arabidopsis thaliana GN=CIPK21 PE=1 SV=1 1047 1270 6.0E-27
sp|P51166|CDK5_XENLA Cyclin-dependent-like kinase 5 OS=Xenopus laevis GN=cdk5 PE=2 SV=1 1047 1317 6.0E-27
sp|Q92207|HOG1_CANAL Mitogen-activated protein kinase HOG1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HOG1 PE=1 SV=2 1044 1344 7.0E-27
sp|Q9FX43|M2K9_ARATH Mitogen-activated protein kinase kinase 9 OS=Arabidopsis thaliana GN=MKK9 PE=1 SV=1 1052 1317 8.0E-27
sp|P57058|HUNK_HUMAN Hormonally up-regulated neu tumor-associated kinase OS=Homo sapiens GN=HUNK PE=1 SV=1 1054 1317 8.0E-27
sp|P31938|MP2K1_MOUSE Dual specificity mitogen-activated protein kinase kinase 1 OS=Mus musculus GN=Map2k1 PE=1 SV=2 1054 1317 8.0E-27
sp|Q68UT7|HUNK_PANTR Hormonally up-regulated neu tumor-associated kinase OS=Pan troglodytes GN=HUNK PE=3 SV=1 1054 1317 9.0E-27
sp|Q9GN62|PAR4_CAEEL Serine/threonine-protein kinase par-4 OS=Caenorhabditis elegans GN=par-4 PE=1 SV=2 1051 1319 9.0E-27
sp|Q00526|CDK3_HUMAN Cyclin-dependent kinase 3 OS=Homo sapiens GN=CDK3 PE=1 SV=1 1048 1317 9.0E-27
sp|Q8C0X8|SMKX_MOUSE Sperm motility kinase X OS=Mus musculus PE=2 SV=1 1054 1358 9.0E-27
sp|P49615|CDK5_MOUSE Cyclin-dependent-like kinase 5 OS=Mus musculus GN=Cdk5 PE=1 SV=1 1047 1317 1.0E-26
sp|Q02399|CDK5_BOVIN Cyclin-dependent-like kinase 5 OS=Bos taurus GN=CDK5 PE=1 SV=2 1047 1317 1.0E-26
sp|Q9HGY5|PHO85_CANAX Negative regulator of the PHO system OS=Candida albicans GN=PHO85 PE=3 SV=1 1042 1320 1.0E-26
sp|Q7ZZC8|NEK9_XENLA Serine/threonine-protein kinase Nek9 OS=Xenopus laevis GN=nek9 PE=2 SV=1 1054 1326 1.0E-26
sp|B1WAS2|HUNK_XENTR Hormonally up-regulated neu tumor-associated kinase homolog OS=Xenopus tropicalis GN=hunk PE=2 SV=1 1051 1317 1.0E-26
sp|Q7RJG2|CDPK4_PLAYO Calcium-dependent protein kinase 4 OS=Plasmodium yoelii yoelii GN=CPK4 PE=3 SV=3 1027 1323 1.0E-26
sp|Q60EY8|CIPKK_ORYSJ CBL-interacting protein kinase 20 OS=Oryza sativa subsp. japonica GN=CIPK20 PE=2 SV=1 1041 1317 1.0E-26
sp|P62345|CDPK4_PLABA Calcium-dependent protein kinase 4 OS=Plasmodium berghei (strain Anka) GN=CPK4 PE=1 SV=2 1027 1323 1.0E-26
sp|Q3UGM2|NEK10_MOUSE Serine/threonine-protein kinase Nek10 OS=Mus musculus GN=Nek10 PE=2 SV=2 1014 1311 1.0E-26
sp|D3ZGQ5|NEK8_RAT Serine/threonine-protein kinase Nek8 OS=Rattus norvegicus GN=Nek8 PE=1 SV=1 1047 1322 1.0E-26
sp|Q9XA16|PKNX_STRCO Probable serine/threonine-protein kinase SCO3848 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO3848 PE=3 SV=1 1047 1305 1.0E-26
sp|Q54VI1|FHKE_DICDI Probable serine/threonine-protein kinase fhkE OS=Dictyostelium discoideum GN=fhkE PE=3 SV=1 1047 1317 1.0E-26
sp|Q8ICR0|CDPK2_PLAF7 Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate 3D7) GN=CPK2 PE=2 SV=3 1054 1317 1.0E-26
sp|Q9HFW2|CLA4_ASHGO Serine/threonine-protein kinase CLA4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CLA4 PE=3 SV=1 1015 1317 1.0E-26
sp|O61267|LOK_DROME Ovarian-specific serine/threonine-protein kinase Lok OS=Drosophila melanogaster GN=lok PE=2 SV=1 1054 1317 1.0E-26
sp|Q00535|CDK5_HUMAN Cyclin-dependent-like kinase 5 OS=Homo sapiens GN=CDK5 PE=1 SV=3 1047 1317 1.0E-26
sp|O15865|CDPK2_PLAFK Calcium-dependent protein kinase 2 OS=Plasmodium falciparum (isolate K1 / Thailand) GN=CPK2 PE=1 SV=3 1054 1317 1.0E-26
sp|Q91447|MP2K1_SERCA Dual specificity mitogen-activated protein kinase kinase 1 (Fragment) OS=Serinus canaria GN=MAP2K1 PE=2 SV=1 1054 1335 1.0E-26
sp|O08648|M3K4_MOUSE Mitogen-activated protein kinase kinase kinase 4 OS=Mus musculus GN=Map3k4 PE=1 SV=2 470 949 1.0E-12
sp|Q9Y6R4|M3K4_HUMAN Mitogen-activated protein kinase kinase kinase 4 OS=Homo sapiens GN=MAP3K4 PE=1 SV=2 470 949 2.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004672 protein kinase activity Yes
GO:0006468 protein phosphorylation Yes
GO:0000166 nucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0006807 nitrogen compound metabolic process No
GO:0036211 protein modification process No
GO:0006796 phosphate-containing compound metabolic process No
GO:0032553 ribonucleotide binding No
GO:0016301 kinase activity No
GO:0140096 catalytic activity, acting on a protein No
GO:0043167 ion binding No
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0006793 phosphorus metabolic process No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0043170 macromolecule metabolic process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0008152 metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0016740 transferase activity No
GO:0030554 adenyl nucleotide binding No
GO:0019538 protein metabolic process No
GO:0044238 primary metabolic process No
GO:0009987 cellular process No
GO:0043412 macromolecule modification No
GO:0036094 small molecule binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0044237 cellular metabolic process No
GO:0071704 organic substance metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0016310 phosphorylation No
GO:0043168 anion binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2973
MAESSPRAVRFFGGNEGEGMGAQGSNGQEGQFDRGSDGRLAGDDSSPGSDGDLHDLEQHDELGHLSRYAASASHA
TSPLPSGVSLNGSGAAAPKSQWNDEVVATPLSNGARPQRPLGPARTPSSTYNPATSRKPTLQQQQPPFLSESIRS
SSKTRMRQSESRFRAQERVYVQKLRQDYSGEYFAPYQGTMANDSDSEGETPSSEGPFDDRLDQETIMFYGNDDLQ
PTEEDVKDPESRERLEWHGMLEAVLTGDVVRQEKKRLIGSADQQGANSAHKSELWLGVRAESCGRRLPVQRRMVE
EARATVDRTLDEIINFEVKGESEVGKPPYQQVKDIVRKIEKCESLYPSWKSLAAEHKAADSPLFGEAYDAIFSWY
NTNEMISTELSILKKWVGNDDLDFSRTKQRSPAVNGIATDETFLDKLMKEDGLQSLYNDDERSTQKGMLWPISSI
IKKVKETLIHNSAPFQKRHLPPYLEELLTLISFPSRLIEEITKTRLAYARRVKETAQQNSLMQDQMISQFQLLLK
FAIRIKLEYLAIESPEPGWELPPCIDESFDQVVLEALKYYFKMLNWKLSGNKNTFKEAELLFQEWDFANDIGSHL
QGGHVEVAEQFSSLTFKALNRLSQTFERELQVKPKESAADMSKRYKACLDSVRVRQRMLQRFSRMLTDNYEHVSD
FSISFPPEAMQKFYDHLVMSGHFRVETGVFEKQGTYIIASPQLRGRLEDIQAMMAITSKEKFPDEYGEQYLLILR
PEDGFSWFGDVVSVPLRQQNIDLKRGQVRLCACASQALAEARRAFLDAVDMHVDLLQESRSNIHKVHTRLLEIRR
VAYKLSNTFMDSVEVIRRQTEGRSCQELIQTCFVFATEFGQRSLLYMDSNRRQMNNLKLTKLALDWVSFICDDCI
ASDRKTFRWAVLALEFAMGMTRGRHILALGEDEYEKLRTKVGGCMSLLISHFDIMGARSNLAAQAEKEKLEQLMG
QFRKIDKNRMLEDDEAWRCIMDQRAQQLEKVEQYRQEKEAERRALGRVLETNNEADRSLAYLSSSATNVTMRWQQ
GHFVGGGTFGNVYAAMNLDSGHLMAVKEIRLQDPKLIPQIAEKIRDEMGVLEVLDHPNIVSYYGIEVHRDRVYIF
MEFCSGGSLANLLEHGRIEDEQVIIFYALQLLEGLVYLHERGIAHRDIKPENILLNHNGVIKYVDFGAAKVIARQ
GRTLATDLHATKPNKSMTGTPMYMSPEVIKGDNPGRAGAVDIWSLGCVVLEMATGRRPWAHLDNEWAIMYNIAQG
NPPQLPTTDQLSAEGIDFLKKCFTRDPKKRPSAVELLQHEWILAIRSQVVEPATPSEGSGSAQSTPMPTGIGIGI
GAGGAAAGVGPDGFYSS*
Coding >OphauB2|2973
ATGGCTGAATCGTCGCCACGAGCCGTGCGATTCTTTGGCGGAAATGAGGGAGAGGGAATGGGTGCACAGGGGAGC
AATGGCCAAGAGGGACAGTTTGACAGAGGCTCAGACGGCAGGCTGGCGGGTGACGACTCTTCTCCCGGCTCCGAC
GGCGACCTCCATGACTTGGAGCAGCACGACGAGCTTGGCCATCTGAGCAGATACGCAGCCTCTGCGTCGCACGCC
ACCTCGCCGCTGCCTTCGGGCGTCAGCCTCAATGGCTCAGGTGCTGCAGCGCCCAAGAGCCAGTGGAACGACGAG
GTCGTAGCAACACCCTTGTCCAATGGAGCTCGGCCTCAGCGACCCTTGGGTCCTGCTCGAACGCCCTCGAGCACG
TACAACCCTGCCACGTCGCGCAAGCCCACTCTCCAGCAGCAGCAGCCGCCGTTTCTTTCCGAGTCGATTCGCTCG
TCGTCCAAGACACGAATGAGACAGAGCGAGAGCCGATTCCGAGCCCAAGAGCGGGTCTACGTGCAGAAGCTGCGA
CAGGACTACTCGGGAGAATACTTTGCTCCCTACCAGGGCACCATGGCCAACGATTCCGACTCGGAGGGCGAGACG
CCATCGTCTGAGGGCCCCTTTGACGACCGGCTTGATCAGGAAACAATCATGTTCTACGGCAATGACGACCTTCAG
CCGACTGAGGAAGACGTCAAGGATCCCGAGAGTCGCGAGAGGCTTGAATGGCATGGGATGCTCGAGGCTGTCCTT
ACTGGCGATGTTGTGCGGCAGGAGAAGAAGCGTCTGATTGGTTCTGCCGACCAGCAAGGCGCAAATTCGGCTCAC
AAATCGGAGCTCTGGCTGGGCGTGCGCGCTGAATCGTGTGGCCGCCGCCTGCCGGTTCAGCGCCGCATGGTCGAA
GAGGCTCGCGCAACCGTGGATCGGACTCTGGATGAAATCATCAACTTCGAGGTCAAGGGCGAGAGCGAGGTTGGC
AAGCCGCCCTATCAACAAGTCAAGGACATTGTGCGCAAGATTGAAAAGTGTGAGAGTCTGTATCCCTCGTGGAAG
TCGCTCGCTGCTGAACACAAGGCTGCCGACTCGCCGCTTTTTGGCGAAGCCTATGACGCAATATTTTCATGGTAC
AACACGAATGAAATGATAAGCACGGAGCTCTCAATCCTCAAAAAATGGGTGGGCAACGACGACCTCGACTTTTCT
CGCACCAAACAACGATCCCCCGCTGTCAATGGCATTGCTACTGACGAAACGTTCCTCGACAAGCTGATGAAGGAA
GATGGCTTGCAGTCACTGTATAATGACGACGAGCGGTCGACGCAAAAGGGCATGCTGTGGCCCATTTCGTCCATT
ATTAAAAAGGTCAAGGAGACACTGATTCACAATTCAGCCCCTTTCCAAAAACGGCACCTGCCGCCGTATCTGGAA
GAACTCCTGACCCTAATTAGTTTTCCCTCACGTCTGATTGAGGAAATCACAAAGACGCGCCTCGCATATGCCAGA
CGAGTCAAGGAGACGGCTCAACAAAACTCTCTGATGCAGGACCAGATGATATCCCAGTTTCAATTGCTTCTCAAG
TTTGCCATTAGAATCAAGCTTGAGTATTTGGCCATTGAGAGCCCAGAGCCGGGCTGGGAGCTGCCTCCGTGCATC
GACGAGTCGTTTGACCAAGTGGTGTTGGAAGCACTCAAGTATTATTTCAAGATGCTCAACTGGAAACTAAGCGGA
AACAAGAACACGTTCAAGGAGGCCGAGTTGCTGTTCCAAGAGTGGGATTTTGCCAACGACATTGGCAGCCATCTA
CAGGGCGGCCATGTGGAAGTGGCTGAGCAGTTTAGCTCTCTCACCTTCAAAGCCCTCAACCGACTGAGCCAGACA
TTTGAGCGAGAACTGCAGGTCAAGCCCAAAGAGAGCGCAGCCGACATGAGCAAGCGGTACAAGGCTTGCCTAGAT
TCGGTTCGTGTGCGGCAGCGAATGCTGCAGCGATTCTCAAGAATGTTGACCGACAACTATGAGCACGTGTCTGAC
TTTAGCATCTCGTTTCCGCCCGAGGCCATGCAAAAGTTTTATGACCACCTCGTAATGTCGGGCCACTTTCGGGTG
GAGACGGGCGTCTTTGAAAAACAGGGCACCTACATTATTGCGTCGCCACAGCTGCGTGGGCGGCTCGAGGACATA
CAGGCAATGATGGCAATCACGTCCAAAGAAAAGTTTCCAGACGAGTATGGCGAGCAATATCTGCTCATTCTGCGA
CCAGAAGACGGATTCAGCTGGTTTGGCGATGTTGTATCCGTGCCTCTGCGGCAGCAGAACATTGACCTGAAAAGA
GGACAGGTTCGGCTGTGTGCGTGTGCGTCGCAGGCGCTGGCCGAGGCACGACGGGCCTTTCTGGATGCCGTGGAC
ATGCACGTAGACTTGCTGCAAGAATCGCGGTCCAACATCCACAAGGTGCACACGAGGCTGCTGGAGATTCGGCGG
GTTGCATACAAGCTGTCCAACACGTTTATGGACAGCGTGGAAGTGATTCGCAGACAGACCGAGGGCCGAAGCTGC
CAAGAGCTGATACAGACTTGCTTTGTCTTTGCAACCGAGTTTGGACAGCGGTCGCTGCTCTACATGGACAGCAAC
AGGCGGCAGATGAACAACCTCAAGCTGACAAAGCTGGCGCTGGACTGGGTGAGTTTTATCTGCGACGACTGCATA
GCGTCGGACCGCAAGACGTTTCGGTGGGCGGTGCTGGCGCTCGAGTTTGCCATGGGCATGACGCGGGGCCGCCAC
ATATTGGCGCTGGGCGAGGACGAGTATGAGAAGCTGCGCACCAAGGTGGGAGGGTGCATGTCGCTGCTCATTTCG
CACTTTGACATCATGGGGGCGCGGTCGAATCTTGCGGCGCAGGCGGAAAAGGAAAAGCTGGAGCAACTCATGGGG
CAGTTTAGAAAGATTGACAAGAACCGCATGCTCGAGGACGACGAGGCTTGGCGATGCATCATGGACCAGCGCGCA
CAGCAGCTTGAAAAGGTGGAGCAGTACCGGCAAGAAAAGGAGGCGGAGCGGCGGGCGCTGGGGCGGGTGCTGGAG
ACGAACAACGAGGCGGATCGGTCCCTGGCCTATCTGTCGTCGTCGGCCACCAATGTCACGATGCGGTGGCAGCAG
GGCCACTTTGTGGGCGGCGGCACCTTTGGCAATGTGTATGCCGCCATGAACCTCGACTCGGGCCATCTCATGGCG
GTCAAGGAGATTCGGCTGCAGGACCCCAAGCTCATTCCCCAGATTGCGGAGAAGATTCGCGACGAGATGGGCGTG
CTCGAGGTGCTCGACCACCCCAACATTGTGTCGTACTATGGCATCGAGGTGCACCGCGACCGCGTCTACATCTTT
ATGGAGTTTTGCTCGGGCGGGTCGCTGGCCAATCTGCTCGAGCACGGCCGCATCGAAGACGAGCAGGTCATTATT
TTTTATGCCTTGCAGCTGCTTGAGGGGCTGGTCTATCTGCACGAGCGCGGCATTGCCCACCGCGACATCAAGCCC
GAGAACATCTTGCTCAACCACAACGGCGTCATCAAGTACGTCGACTTTGGAGCGGCCAAGGTGATTGCCCGCCAG
GGGCGCACGCTGGCCACGGACCTGCACGCCACCAAGCCTAACAAGTCCATGACGGGCACGCCCATGTACATGTCG
CCCGAGGTCATCAAGGGCGACAATCCAGGCCGGGCGGGAGCCGTCGACATTTGGTCTCTGGGCTGCGTGGTGCTT
GAAATGGCAACAGGACGCCGACCGTGGGCCCATTTGGACAATGAGTGGGCCATTATGTACAATATTGCACAGGGC
AATCCGCCGCAGCTGCCGACGACGGACCAGCTGAGTGCCGAGGGCATCGATTTTCTCAAAAAATGCTTTACCCGC
GATCCCAAGAAGCGGCCCTCGGCTGTTGAGCTGTTGCAGCACGAGTGGATCCTGGCTATTCGAAGCCAGGTTGTT
GAACCGGCAACGCCCAGCGAGGGCAGTGGCTCTGCTCAATCGACGCCCATGCCGACAGGAATAGGAATAGGCATA
GGAGCAGGAGGCGCGGCAGCCGGCGTCGGGCCCGATGGCTTTTATTCATCTTGA
Transcript >OphauB2|2973
ATGGCTGAATCGTCGCCACGAGCCGTGCGATTCTTTGGCGGAAATGAGGGAGAGGGAATGGGTGCACAGGGGAGC
AATGGCCAAGAGGGACAGTTTGACAGAGGCTCAGACGGCAGGCTGGCGGGTGACGACTCTTCTCCCGGCTCCGAC
GGCGACCTCCATGACTTGGAGCAGCACGACGAGCTTGGCCATCTGAGCAGATACGCAGCCTCTGCGTCGCACGCC
ACCTCGCCGCTGCCTTCGGGCGTCAGCCTCAATGGCTCAGGTGCTGCAGCGCCCAAGAGCCAGTGGAACGACGAG
GTCGTAGCAACACCCTTGTCCAATGGAGCTCGGCCTCAGCGACCCTTGGGTCCTGCTCGAACGCCCTCGAGCACG
TACAACCCTGCCACGTCGCGCAAGCCCACTCTCCAGCAGCAGCAGCCGCCGTTTCTTTCCGAGTCGATTCGCTCG
TCGTCCAAGACACGAATGAGACAGAGCGAGAGCCGATTCCGAGCCCAAGAGCGGGTCTACGTGCAGAAGCTGCGA
CAGGACTACTCGGGAGAATACTTTGCTCCCTACCAGGGCACCATGGCCAACGATTCCGACTCGGAGGGCGAGACG
CCATCGTCTGAGGGCCCCTTTGACGACCGGCTTGATCAGGAAACAATCATGTTCTACGGCAATGACGACCTTCAG
CCGACTGAGGAAGACGTCAAGGATCCCGAGAGTCGCGAGAGGCTTGAATGGCATGGGATGCTCGAGGCTGTCCTT
ACTGGCGATGTTGTGCGGCAGGAGAAGAAGCGTCTGATTGGTTCTGCCGACCAGCAAGGCGCAAATTCGGCTCAC
AAATCGGAGCTCTGGCTGGGCGTGCGCGCTGAATCGTGTGGCCGCCGCCTGCCGGTTCAGCGCCGCATGGTCGAA
GAGGCTCGCGCAACCGTGGATCGGACTCTGGATGAAATCATCAACTTCGAGGTCAAGGGCGAGAGCGAGGTTGGC
AAGCCGCCCTATCAACAAGTCAAGGACATTGTGCGCAAGATTGAAAAGTGTGAGAGTCTGTATCCCTCGTGGAAG
TCGCTCGCTGCTGAACACAAGGCTGCCGACTCGCCGCTTTTTGGCGAAGCCTATGACGCAATATTTTCATGGTAC
AACACGAATGAAATGATAAGCACGGAGCTCTCAATCCTCAAAAAATGGGTGGGCAACGACGACCTCGACTTTTCT
CGCACCAAACAACGATCCCCCGCTGTCAATGGCATTGCTACTGACGAAACGTTCCTCGACAAGCTGATGAAGGAA
GATGGCTTGCAGTCACTGTATAATGACGACGAGCGGTCGACGCAAAAGGGCATGCTGTGGCCCATTTCGTCCATT
ATTAAAAAGGTCAAGGAGACACTGATTCACAATTCAGCCCCTTTCCAAAAACGGCACCTGCCGCCGTATCTGGAA
GAACTCCTGACCCTAATTAGTTTTCCCTCACGTCTGATTGAGGAAATCACAAAGACGCGCCTCGCATATGCCAGA
CGAGTCAAGGAGACGGCTCAACAAAACTCTCTGATGCAGGACCAGATGATATCCCAGTTTCAATTGCTTCTCAAG
TTTGCCATTAGAATCAAGCTTGAGTATTTGGCCATTGAGAGCCCAGAGCCGGGCTGGGAGCTGCCTCCGTGCATC
GACGAGTCGTTTGACCAAGTGGTGTTGGAAGCACTCAAGTATTATTTCAAGATGCTCAACTGGAAACTAAGCGGA
AACAAGAACACGTTCAAGGAGGCCGAGTTGCTGTTCCAAGAGTGGGATTTTGCCAACGACATTGGCAGCCATCTA
CAGGGCGGCCATGTGGAAGTGGCTGAGCAGTTTAGCTCTCTCACCTTCAAAGCCCTCAACCGACTGAGCCAGACA
TTTGAGCGAGAACTGCAGGTCAAGCCCAAAGAGAGCGCAGCCGACATGAGCAAGCGGTACAAGGCTTGCCTAGAT
TCGGTTCGTGTGCGGCAGCGAATGCTGCAGCGATTCTCAAGAATGTTGACCGACAACTATGAGCACGTGTCTGAC
TTTAGCATCTCGTTTCCGCCCGAGGCCATGCAAAAGTTTTATGACCACCTCGTAATGTCGGGCCACTTTCGGGTG
GAGACGGGCGTCTTTGAAAAACAGGGCACCTACATTATTGCGTCGCCACAGCTGCGTGGGCGGCTCGAGGACATA
CAGGCAATGATGGCAATCACGTCCAAAGAAAAGTTTCCAGACGAGTATGGCGAGCAATATCTGCTCATTCTGCGA
CCAGAAGACGGATTCAGCTGGTTTGGCGATGTTGTATCCGTGCCTCTGCGGCAGCAGAACATTGACCTGAAAAGA
GGACAGGTTCGGCTGTGTGCGTGTGCGTCGCAGGCGCTGGCCGAGGCACGACGGGCCTTTCTGGATGCCGTGGAC
ATGCACGTAGACTTGCTGCAAGAATCGCGGTCCAACATCCACAAGGTGCACACGAGGCTGCTGGAGATTCGGCGG
GTTGCATACAAGCTGTCCAACACGTTTATGGACAGCGTGGAAGTGATTCGCAGACAGACCGAGGGCCGAAGCTGC
CAAGAGCTGATACAGACTTGCTTTGTCTTTGCAACCGAGTTTGGACAGCGGTCGCTGCTCTACATGGACAGCAAC
AGGCGGCAGATGAACAACCTCAAGCTGACAAAGCTGGCGCTGGACTGGGTGAGTTTTATCTGCGACGACTGCATA
GCGTCGGACCGCAAGACGTTTCGGTGGGCGGTGCTGGCGCTCGAGTTTGCCATGGGCATGACGCGGGGCCGCCAC
ATATTGGCGCTGGGCGAGGACGAGTATGAGAAGCTGCGCACCAAGGTGGGAGGGTGCATGTCGCTGCTCATTTCG
CACTTTGACATCATGGGGGCGCGGTCGAATCTTGCGGCGCAGGCGGAAAAGGAAAAGCTGGAGCAACTCATGGGG
CAGTTTAGAAAGATTGACAAGAACCGCATGCTCGAGGACGACGAGGCTTGGCGATGCATCATGGACCAGCGCGCA
CAGCAGCTTGAAAAGGTGGAGCAGTACCGGCAAGAAAAGGAGGCGGAGCGGCGGGCGCTGGGGCGGGTGCTGGAG
ACGAACAACGAGGCGGATCGGTCCCTGGCCTATCTGTCGTCGTCGGCCACCAATGTCACGATGCGGTGGCAGCAG
GGCCACTTTGTGGGCGGCGGCACCTTTGGCAATGTGTATGCCGCCATGAACCTCGACTCGGGCCATCTCATGGCG
GTCAAGGAGATTCGGCTGCAGGACCCCAAGCTCATTCCCCAGATTGCGGAGAAGATTCGCGACGAGATGGGCGTG
CTCGAGGTGCTCGACCACCCCAACATTGTGTCGTACTATGGCATCGAGGTGCACCGCGACCGCGTCTACATCTTT
ATGGAGTTTTGCTCGGGCGGGTCGCTGGCCAATCTGCTCGAGCACGGCCGCATCGAAGACGAGCAGGTCATTATT
TTTTATGCCTTGCAGCTGCTTGAGGGGCTGGTCTATCTGCACGAGCGCGGCATTGCCCACCGCGACATCAAGCCC
GAGAACATCTTGCTCAACCACAACGGCGTCATCAAGTACGTCGACTTTGGAGCGGCCAAGGTGATTGCCCGCCAG
GGGCGCACGCTGGCCACGGACCTGCACGCCACCAAGCCTAACAAGTCCATGACGGGCACGCCCATGTACATGTCG
CCCGAGGTCATCAAGGGCGACAATCCAGGCCGGGCGGGAGCCGTCGACATTTGGTCTCTGGGCTGCGTGGTGCTT
GAAATGGCAACAGGACGCCGACCGTGGGCCCATTTGGACAATGAGTGGGCCATTATGTACAATATTGCACAGGGC
AATCCGCCGCAGCTGCCGACGACGGACCAGCTGAGTGCCGAGGGCATCGATTTTCTCAAAAAATGCTTTACCCGC
GATCCCAAGAAGCGGCCCTCGGCTGTTGAGCTGTTGCAGCACGAGTGGATCCTGGCTATTCGAAGCCAGGTTGTT
GAACCGGCAACGCCCAGCGAGGGCAGTGGCTCTGCTCAATCGACGCCCATGCCGACAGGAATAGGAATAGGCATA
GGAGCAGGAGGCGCGGCAGCCGGCGTCGGGCCCGATGGCTTTTATTCATCTTGA
Gene >OphauB2|2973
ATGGCTGAATCGTCGCCACGAGCCGTGCGATTCTTTGGCGGAAATGAGGGAGAGGGAATGGGTGCACAGGGGAGC
AATGGCCAAGAGGGACAGTTTGACAGAGGCTCAGACGGCAGGCTGGCGGGTGACGACTCTTCTCCCGGCTCCGAC
GGCGACCTCCATGACTTGGAGCAGCACGACGAGCTTGGCCATCTGAGCAGATACGCAGCCTCTGCGTCGCACGCC
ACCTCGCCGCTGCCTTCGGGCGTCAGCCTCAATGGCTCAGGTGCTGCAGCGCCCAAGAGCCAGTGGAACGACGAG
GTCGTAGCAACACCCTTGTCCAATGGAGCTCGGCCTCAGCGACCCTTGGGTCCTGCTCGAACGCCCTCGAGCACG
TACAACCCTGCCACGTCGCGCAAGCCCACTCTCCAGCAGCAGCAGCCGCCGTTTCTTTCCGAGTCGATTCGCTCG
TCGTCCAAGACACGAATGAGACAGAGCGAGAGCCGATTCCGAGCCCAAGAGCGGGTCTACGTGCAGAAGCTGCGA
CAGGACTACTCGGGAGAATACTTTGCTCCCTACCAGGGCACCATGGCCAACGATTCCGACTCGGAGGGCGAGACG
CCATCGTCTGAGGGCCCCTTTGACGACCGGCTTGATCAGGAAACAATCATGTTCTACGGCAATGACGACCTTCAG
CCGACTGAGGAAGACGTCAAGGATCCCGAGAGTCGCGAGAGGCTTGAATGGCATGGGATGCTCGAGGCTGTCCTT
ACTGGCGATGTTGTGCGGCAGGAGAAGAAGCGTCTGATTGGTTCTGCCGACCAGCAAGGCGCAAATTCGGCTCAC
AAATCGGAGCTCTGGCTGGGCGTGCGCGCTGAATCGTGTGGCCGCCGCCTGCCGGTTCAGCGCCGCATGGTCGAA
GAGGCTCGCGCAACCGTGGATCGGACTCTGGATGAAATCATCAACTTCGAGGTCAAGGGCGAGAGCGAGGTTGGC
AAGCCGCCCTATCAACAAGTCAAGGACATTGTGCGCAAGATTGAAAAGTGTGAGAGTCTGTATCCCTCGTGGAAG
TCGCTCGCTGCTGAACACAAGGCTGCCGACTCGCCGCTTTTTGGCGAAGCCTATGACGCAATATTTTCATGGTAC
AACACGAATGAAATGATAAGCACGGAGCTCTCAATCCTCAAAAAATGGGTGGGCAACGACGACCTCGACTTTTCT
CGCACCAAACAACGATCCCCCGCTGTCAATGGCATTGCTACTGACGAAACGTTCCTCGACAAGCTGATGAAGGAA
GATGGCTTGCAGTCACTGTATAATGACGACGAGCGGTCGACGCAAAAGGGCATGCTGTGGCCCATTTCGTCCATT
ATTAAAAAGGTCAAGGAGACACTGATTCACAATTCAGCCCCTTTCCAAAAACGGCACCTGCCGCCGTATCTGGAA
GAACTCCTGACCCTAATTAGTTTTCCCTCACGTCTGATTGAGGAAATCACAAAGACGCGCCTCGCATATGCCAGA
CGAGTCAAGGAGACGGCTCAACAAAACTCTCTGATGCAGGACCAGATGATATCCCAGTTTCAATTGCTTCTCAAG
TTTGCCATTAGAATCAAGCTTGAGTATTTGGCCATTGAGAGCCCAGAGCCGGGCTGGGAGCTGCCTCCGTGCATC
GACGAGTCGTTTGACCAAGTGGTGTTGGAAGCACTCAAGTATTATTTCAAGATGCTCAACTGGAAACTAAGCGGA
AACAAGAACACGTTCAAGGAGGCCGAGTTGCTGTTCCAAGAGTGGGATTTTGCCAACGACATTGGCAGCCATCTA
CAGGGCGGCCATGTGGAAGTGGCTGAGCAGTTTAGCTCTCTCACCTTCAAAGCCCTCAACCGACTGAGCCAGACA
TTTGAGCGAGAACTGCAGGTCAAGCCCAAAGAGAGCGCAGCCGACATGAGCAAGCGGTACAAGGCTTGCCTAGAT
TCGGTTCGTGTGCGGCAGCGAATGCTGCAGCGATTCTCAAGAATGTTGACCGACAACTATGAGCACGTGTCTGAC
TTTAGCATCTCGTTTCCGCCCGAGGCCATGCAAAAGTTTTATGACCACCTCGTAATGTCGGGCCACTTTCGGGTG
GAGACGGGCGTCTTTGAAAAACAGGGCACCTACATTATTGCGTCGCCACAGCTGCGTGGGCGGCTCGAGGACATA
CAGGCAATGATGGCAATCACGTCCAAAGAAAAGTTTCCAGACGAGTATGGCGAGCAATATCTGCTCATTCTGCGA
CCAGAAGACGGATTCAGCTGGTTTGGCGATGTTGTATCCGTGCCTCTGCGGCAGCAGAACATTGACCTGAAAAGA
GGACAGGTTCGGCTGTGTGCGTGTGCGTCGCAGGCGCTGGCCGAGGCACGACGGGCCTTTCTGGATGCCGTGGAC
ATGCACGTAGACTTGCTGCAAGAATCGCGGTCCAACATCCACAAGGTGCACACGAGGCTGCTGGAGATTCGGCGG
GTTGCATACAAGCTGTCCAACACGTTTATGGACAGCGTGGAAGTGATTCGCAGACAGACCGAGGGCCGAAGCTGC
CAAGAGCTGATACAGACTTGCTTTGTCTTTGCAACCGAGTTTGGACAGCGGTCGCTGCTCTACATGGACAGCAAC
AGGCGGCAGATGAACAACCTCAAGCTGACAAAGCTGGCGCTGGACTGGGTGAGTTTTATCTGCGACGACTGCATA
GCGTCGGACCGCAAGACGTTTCGGTGGGCGGTGCTGGCGCTCGAGTTTGCCATGGGCATGACGCGGGGCCGCCAC
ATATTGGCGCTGGGCGAGGACGAGTATGAGAAGCTGCGCACCAAGGTGGGAGGGTGCATGTCGCTGCTCATTTCG
CACTTTGACATCATGGGGGCGCGGTCGAATCTTGCGGCGCAGGCGGAAAAGGAAAAGCTGGAGCAACTCATGGGG
CAGTTTAGAAAGATTGACAAGAACCGCATGCTCGAGGACGACGAGGCTTGGCGATGCATCATGGACCAGCGCGCA
CAGCAGCTTGAAAAGGTGGAGCAGTACCGGCAAGAAAAGGAGGCGGAGCGGCGGGCGCTGGGGCGGGTGCTGGAG
ACGAACAACGAGGCGGATCGGTCCCTGGCCTATCTGTCGTCGTCGGCCACCAATGTCACGATGCGGTGGCAGCAG
GGCCACTTTGTGGGCGGCGGCACCTTTGGCAATGTGTATGCCGCCATGAACCTCGACTCGGGCCATCTCATGGCG
GTCAAGGAGATTCGGCTGCAGGACCCCAAGCTCATTCCCCAGATTGCGGAGAAGATTCGCGACGAGATGGGCGTG
CTCGAGGTGCTCGACCACCCCAACATTGTGTCGTACTATGGCATCGAGGTGCACCGCGACCGCGTCTACATCTTT
ATGGAGTTTTGCTCGGGCGGGTCGCTGGCCAATCTGCTCGAGCACGGCCGCATCGAAGACGAGCAGGTCATTATT
TTTTATGCCTTGCAGCTGCTTGAGGGGCTGGTCTATCTGCACGAGCGCGGCATTGCCCACCGCGACATCAAGCCC
GAGAGTAAGAGGCATGCCCCTTGTCCATGAGCCTGAGCGTGTTGCGGCTAACGCGTTGCGTGACAGACATCTTGC
TCAACCACAACGGCGTCATCAAGTACGTCGACTTTGGAGCGGCCAAGGTGATTGCCCGCCAGGGGCGCACGCTGG
CCACGGACCTGCACGCCACCAAGCCTAACAAGTCCATGACGGGCACGCCCATGTACATGTCGCCCGAGGTCATCA
AGGGCGACAATCCAGGCCGGGCGGGAGCCGTCGACATTTGGTCTCTGGGCTGCGTGGTGCTTGAAATGGCAACAG
GACGCCGACCGTGGGCCCATTTGGACAATGAGTGGGCCATTATGTACAATATTGCACAGGGCAATCCGCCGCAGC
TGCCGACGACGGACCAGCTGAGTGCCGAGGGCATCGATTTTCTCAAAAAATGCTTTACCCGCGATCCCAAGAAGC
GGCCCTCGGCTGTTGAGCTGTTGCAGCACGAGTGGATCCTGGCTATTCGAAGCCAGGTTGTTGAACCGGCAACGC
CCAGCGAGGGCAGTGGCTCTGCTCAATCGACGCCCATGCCGACAGGAATAGGAATAGGCATAGGAGCAGGAGGCG
CGGCAGCCGGCGTCGGGCCCGATGGCTTTTATTCATCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail