Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2963
Gene name
LocationContig_2:172187..173974
Strand-
Gene length (bp)1787
Transcript length (bp)1503
Coding sequence length (bp)1503
Protein length (aa) 501

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 2.6E-07 308 359

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IQW0|NOP12_GIBZE Nucleolar protein 12 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=NOP12 PE=3 SV=1 82 497 1.0E-150
sp|Q7S2L7|NOP12_NEUCR Nucleolar protein 12 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nop-12 PE=3 SV=1 16 494 6.0E-118
sp|Q4WCH5|NOP12_ASPFU Nucleolar protein 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nop12 PE=3 SV=1 7 486 3.0E-98
sp|Q5BDC8|NOP12_EMENI Nucleolar protein 12 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nop12 PE=3 SV=1 7 462 1.0E-89
sp|Q6C2Q7|NOP12_YARLI Nucleolar protein 12 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=NOP12 PE=3 SV=1 92 494 9.0E-44
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IQW0|NOP12_GIBZE Nucleolar protein 12 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=NOP12 PE=3 SV=1 82 497 1.0E-150
sp|Q7S2L7|NOP12_NEUCR Nucleolar protein 12 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nop-12 PE=3 SV=1 16 494 6.0E-118
sp|Q4WCH5|NOP12_ASPFU Nucleolar protein 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nop12 PE=3 SV=1 7 486 3.0E-98
sp|Q5BDC8|NOP12_EMENI Nucleolar protein 12 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nop12 PE=3 SV=1 7 462 1.0E-89
sp|Q6C2Q7|NOP12_YARLI Nucleolar protein 12 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=NOP12 PE=3 SV=1 92 494 9.0E-44
sp|O13741|NOP12_SCHPO Nucleolar protein 12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nop12 PE=1 SV=1 12 434 5.0E-43
sp|Q08208|NOP12_YEAST Nucleolar protein 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NOP12 PE=1 SV=1 10 500 7.0E-43
sp|Q6FUS6|NOP12_CANGA Nucleolar protein 12 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=NOP12 PE=3 SV=1 148 379 2.0E-42
sp|Q75BJ7|NOP12_ASHGO Nucleolar protein 12 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=NOP12 PE=3 SV=1 103 424 5.0E-42
sp|Q6CKV6|NOP12_KLULA Nucleolar protein 12 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=NOP12 PE=3 SV=2 148 461 4.0E-39
sp|Q6BTS9|NOP12_DEBHA Nucleolar protein 12 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=NOP12 PE=3 SV=2 16 482 2.0E-38
sp|Q5AHI7|NOP12_CANAL Nucleolar protein 12 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NOP12 PE=3 SV=1 85 461 1.0E-34
sp|P42696|RBM34_HUMAN RNA-binding protein 34 OS=Homo sapiens GN=RBM34 PE=1 SV=2 75 378 8.0E-17
sp|Q5M9F1|RBM34_RAT RNA-binding protein 34 OS=Rattus norvegicus GN=Rbm34 PE=1 SV=1 154 407 1.0E-15
sp|Q8C5L7|RBM34_MOUSE RNA-binding protein 34 OS=Mus musculus GN=Rbm34 PE=1 SV=1 154 378 3.0E-15
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No
GO:0003676 nucleic acid binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2963
MSTRPAPALGLSTEAIDPALHALFAYSSGPLQKPQPPSASKSTSNGRLVIQHGQIDESSDSIAKQASTMASLVGT
NQQLRIRKRKRSDDKPDLEAKYMASLANDNQLEYPNRRLKERDEGDSSSDDIDDDNPGAPIHQSLAPDSSVSEME
RASRTVFLGNVSIEAVSSKQARKTLINHLVSALDSHETTPAKLESFRFRSVAFSSAAMPKRAAYITKSLMESTTH
SANAYAVFSTPAAARKVVCELNGSQVLGRHLRADCVAHPSAIDHRRCVFVGNLGFVDDETVINTDSHGETIEKKR
NKVPSDIEEGLWRTFGNKGKIENVRVVRDAKTRVGKGIAYVQFYDANDVEGALLLNGSKHPPMLPRRLRVTRAKD
PRKTALAQSRSQEKARATAAESAINPRYRSKQSSQDLAAAGRAGKLLGRVGALKQRNRARFAFSHTPVSTVIKSP
EQIVFEGQRASAINGGSGDGKSTKSKRKSMKPNNKSTRRAAEWRRRQTAK*
Coding >OphauB2|2963
ATGTCCACCAGGCCAGCACCAGCCTTGGGCCTTTCTACCGAAGCCATTGATCCGGCTCTCCATGCGCTTTTCGCA
TATAGCTCGGGCCCTCTTCAAAAACCACAGCCGCCGTCAGCCTCCAAGAGCACCTCGAATGGCCGTCTTGTCATC
CAGCATGGTCAAATTGATGAGTCCTCAGATTCCATCGCAAAGCAAGCGTCAACCATGGCCAGTTTGGTGGGAACA
AATCAGCAACTCAGGATTCGCAAGAGAAAGAGAAGCGATGATAAGCCAGACCTCGAGGCAAAGTACATGGCCTCG
CTTGCAAACGACAATCAACTTGAGTATCCCAACAGGCGGCTCAAGGAACGAGACGAGGGCGATAGCAGCAGTGAT
GACATAGACGACGACAATCCAGGAGCGCCAATTCATCAAAGTCTAGCTCCAGATTCAAGCGTGTCCGAAATGGAA
AGGGCGTCAAGGACCGTATTTCTAGGAAACGTGTCCATAGAGGCCGTCTCTTCTAAACAGGCAAGGAAGACACTG
ATTAACCACCTTGTATCCGCGCTCGACTCCCATGAAACAACCCCTGCCAAACTCGAATCTTTTCGGTTTCGTTCA
GTTGCCTTTTCAAGTGCAGCTATGCCAAAGAGGGCCGCCTACATCACTAAGTCTCTCATGGAATCTACAACGCAC
TCCGCCAACGCTTACGCCGTCTTCTCCACACCTGCTGCCGCTCGCAAAGTCGTCTGTGAGCTAAATGGTTCTCAA
GTCCTTGGTCGGCACCTTAGAGCCGATTGCGTTGCCCATCCAAGTGCTATAGATCACCGTCGCTGTGTCTTTGTT
GGCAACCTCGGCTTCGTTGATGATGAAACTGTCATCAATACGGACAGCCATGGCGAGACGATTGAGAAAAAGAGA
AACAAAGTACCATCGGATATCGAGGAGGGGCTTTGGCGAACCTTTGGGAACAAGGGCAAAATTGAGAATGTACGT
GTTGTTCGTGATGCAAAAACTAGAGTCGGCAAGGGAATTGCATATGTGCAGTTTTATGACGCCAATGATGTTGAA
GGTGCTTTGCTACTCAACGGCAGTAAACACCCGCCCATGCTTCCTCGGCGTCTTCGTGTTACTCGAGCAAAGGAC
CCTCGCAAGACAGCATTGGCCCAGTCTCGTTCTCAAGAAAAGGCAAGAGCAACAGCAGCAGAATCTGCTATAAAC
CCTAGATACAGGTCTAAGCAATCTTCACAAGATCTTGCTGCTGCTGGACGCGCAGGCAAGCTGCTTGGGCGAGTC
GGTGCTCTCAAACAGCGCAACCGAGCTCGTTTTGCTTTTTCCCACACGCCCGTATCCACTGTCATTAAATCACCG
GAACAAATCGTCTTTGAGGGACAAAGGGCATCGGCCATTAATGGAGGGTCTGGCGACGGGAAGTCGACTAAATCA
AAGCGCAAGTCGATGAAACCCAACAATAAGAGCACTCGTCGTGCAGCTGAGTGGAGAAGGAGGCAGACAGCAAAG
TAG
Transcript >OphauB2|2963
ATGTCCACCAGGCCAGCACCAGCCTTGGGCCTTTCTACCGAAGCCATTGATCCGGCTCTCCATGCGCTTTTCGCA
TATAGCTCGGGCCCTCTTCAAAAACCACAGCCGCCGTCAGCCTCCAAGAGCACCTCGAATGGCCGTCTTGTCATC
CAGCATGGTCAAATTGATGAGTCCTCAGATTCCATCGCAAAGCAAGCGTCAACCATGGCCAGTTTGGTGGGAACA
AATCAGCAACTCAGGATTCGCAAGAGAAAGAGAAGCGATGATAAGCCAGACCTCGAGGCAAAGTACATGGCCTCG
CTTGCAAACGACAATCAACTTGAGTATCCCAACAGGCGGCTCAAGGAACGAGACGAGGGCGATAGCAGCAGTGAT
GACATAGACGACGACAATCCAGGAGCGCCAATTCATCAAAGTCTAGCTCCAGATTCAAGCGTGTCCGAAATGGAA
AGGGCGTCAAGGACCGTATTTCTAGGAAACGTGTCCATAGAGGCCGTCTCTTCTAAACAGGCAAGGAAGACACTG
ATTAACCACCTTGTATCCGCGCTCGACTCCCATGAAACAACCCCTGCCAAACTCGAATCTTTTCGGTTTCGTTCA
GTTGCCTTTTCAAGTGCAGCTATGCCAAAGAGGGCCGCCTACATCACTAAGTCTCTCATGGAATCTACAACGCAC
TCCGCCAACGCTTACGCCGTCTTCTCCACACCTGCTGCCGCTCGCAAAGTCGTCTGTGAGCTAAATGGTTCTCAA
GTCCTTGGTCGGCACCTTAGAGCCGATTGCGTTGCCCATCCAAGTGCTATAGATCACCGTCGCTGTGTCTTTGTT
GGCAACCTCGGCTTCGTTGATGATGAAACTGTCATCAATACGGACAGCCATGGCGAGACGATTGAGAAAAAGAGA
AACAAAGTACCATCGGATATCGAGGAGGGGCTTTGGCGAACCTTTGGGAACAAGGGCAAAATTGAGAATGTACGT
GTTGTTCGTGATGCAAAAACTAGAGTCGGCAAGGGAATTGCATATGTGCAGTTTTATGACGCCAATGATGTTGAA
GGTGCTTTGCTACTCAACGGCAGTAAACACCCGCCCATGCTTCCTCGGCGTCTTCGTGTTACTCGAGCAAAGGAC
CCTCGCAAGACAGCATTGGCCCAGTCTCGTTCTCAAGAAAAGGCAAGAGCAACAGCAGCAGAATCTGCTATAAAC
CCTAGATACAGGTCTAAGCAATCTTCACAAGATCTTGCTGCTGCTGGACGCGCAGGCAAGCTGCTTGGGCGAGTC
GGTGCTCTCAAACAGCGCAACCGAGCTCGTTTTGCTTTTTCCCACACGCCCGTATCCACTGTCATTAAATCACCG
GAACAAATCGTCTTTGAGGGACAAAGGGCATCGGCCATTAATGGAGGGTCTGGCGACGGGAAGTCGACTAAATCA
AAGCGCAAGTCGATGAAACCCAACAATAAGAGCACTCGTCGTGCAGCTGAGTGGAGAAGGAGGCAGACAGCAAAG
TAG
Gene >OphauB2|2963
ATGTCCACCAGGTGAGTCAAGATTGATGCTGCCAATCGTCCTCGCTCGACTATTCCTTATTAACAGTGTCCCAGG
CCAGCACCAGCCTTGGGCCTTTCTACCGAAGCCATTGATCCGGCTCTCCATGCGCTTTTCGCATATAGCGTGAGT
AGCCAACCTAGGACAAATCATGACCGCCTTGACTCACTCTACTCTCCAAGTCGGGCCCTCTTCAAAAACCACAGC
CGCCGTCAGCCTCCAAGAGCACCTCGAATGGCCGTCTTGTCATCCAGCATGGTCAAATTGATGAGGTGCTCTCTC
AAACAAGCCAAGAACCCGAATGCCATAGCGGCTTCGATTTGGACCAAGACGGCCGTTCACCGCCAATTCCTCATG
ACTTCCCGGTGCAGTCCTCAGATTCCATCGCAAAGCAAGCGTCAACCATGGCCAGTTTGGTGGGAACAAATCAGC
AACTCAGGATTCGCAAGAGAAAGAGAAGCGATGATAAGCCAGACCTCGAGGCAAAGTACATGGCCTCGCTTGCAA
ACGACAATCAACTTGAGTATCCCAACAGGCGGCTCAAGGAACGAGACGAGGGCGATAGCAGCAGTGATGACATAG
ACGACGACAATCCAGGAGCGCCAATTCATCAAAGTCTAGCTCCAGATTCAAGCGTGTCCGAAATGGAAAGGGCGT
CAAGGACCGTATTTCTAGGAAACGTGTCCATAGAGGCCGTCTCTTCTAAACAGGCAAGGAAGACACTGATTAACC
ACCTTGTATCCGCGCTCGACTCCCATGAAACAACCCCTGCCAAACTCGAATCTTTTCGGTTTCGTTCAGTTGCCT
TTTCAAGTGCAGCTATGCCAAAGAGGGCCGCCTACATCACTAAGTCTCTCATGGAATCTACAACGCACTCCGCCA
ACGCTTACGCCGTCTTCTCCACACCTGCTGCCGCTCGCAAAGTCGTCTGTGAGCTAAATGGTTCTCAAGTCCTTG
GTCGGCACCTTAGAGCCGATTGCGTTGCCCATCCAAGTGCTATAGATCACCGTCGCTGTGTCTTTGTTGGCAACC
TCGGCTTCGTTGATGATGAAACTGTCATCAATACGGACAGCCATGGCGAGACGATTGAGAAAAAGAGAAACAAAG
TACCATCGGATATCGAGGAGGGGCTTTGGCGAACCTTTGGGAACAAGGGCAAAATTGAGAATGTACGTGTTGTTC
GTGATGCAAAAACTAGAGTCGGCAAGGGAATTGCATATGTGCAGTTTTATGTAAGTTGACACTTTGCGCTGCTTT
TGATGATAATAGACGACCTTTGTCGATACTGACGGCTACAGGACGCCAATGATGTTGAAGGTGCTTTGCTACTCA
ACGGCAGTAAACACCCGCCCATGCTTCCTCGGCGTCTTCGTGTTACTCGAGCAAAGGACCCTCGCAAGACAGCAT
TGGCCCAGTCTCGTTCTCAAGAAAAGGCAAGAGCAACAGCAGCAGAATCTGCTATAAACCCTAGATACAGGTCTA
AGCAATCTTCACAAGATCTTGCTGCTGCTGGACGCGCAGGCAAGCTGCTTGGGCGAGTCGGTGCTCTCAAACAGC
GCAACCGAGCTCGTTTTGCTTTTTCCCACACGCCCGTATCCACTGTCATTAAATCACCGGAACAAATCGTCTTTG
AGGGACAAAGGGCATCGGCCATTAATGGAGGGTCTGGCGACGGGAAGTCGACTAAATCAAAGCGCAAGTCGATGA
AACCCAACAATAAGAGCACTCGTCGTGCAGCTGAGTGGAGAAGGAGGCAGACAGCAAAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail