Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2950
Gene name
LocationContig_2:140525..142256
Strand-
Gene length (bp)1731
Transcript length (bp)1731
Coding sequence length (bp)1731
Protein length (aa) 577

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00443 UCH Ubiquitin carboxyl-terminal hydrolase 2.6E-34 43 406

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0CAQ1|UBP16_EMENI Ubiquitin carboxyl-terminal hydrolase 16 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ubp16 PE=3 SV=1 1 573 5.0E-166
sp|Q02863|UBP16_YEAST Ubiquitin carboxyl-terminal hydrolase 16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBP16 PE=1 SV=1 11 407 6.0E-32
sp|Q9UK80|UBP21_HUMAN Ubiquitin carboxyl-terminal hydrolase 21 OS=Homo sapiens GN=USP21 PE=1 SV=1 43 404 1.0E-16
sp|Q2KJ72|UBP21_BOVIN Ubiquitin carboxyl-terminal hydrolase 21 OS=Bos taurus GN=USP21 PE=2 SV=1 43 404 1.0E-16
sp|Q9QZL6|UBP21_MOUSE Ubiquitin carboxyl-terminal hydrolase 21 OS=Mus musculus GN=Usp21 PE=1 SV=1 43 404 2.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0CAQ1|UBP16_EMENI Ubiquitin carboxyl-terminal hydrolase 16 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ubp16 PE=3 SV=1 1 573 5.0E-166
sp|Q02863|UBP16_YEAST Ubiquitin carboxyl-terminal hydrolase 16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBP16 PE=1 SV=1 11 407 6.0E-32
sp|Q9UK80|UBP21_HUMAN Ubiquitin carboxyl-terminal hydrolase 21 OS=Homo sapiens GN=USP21 PE=1 SV=1 43 404 1.0E-16
sp|Q2KJ72|UBP21_BOVIN Ubiquitin carboxyl-terminal hydrolase 21 OS=Bos taurus GN=USP21 PE=2 SV=1 43 404 1.0E-16
sp|Q9QZL6|UBP21_MOUSE Ubiquitin carboxyl-terminal hydrolase 21 OS=Mus musculus GN=Usp21 PE=1 SV=1 43 404 2.0E-16
sp|B2GUX4|UBP21_RAT Ubiquitin carboxyl-terminal hydrolase 21 OS=Rattus norvegicus GN=Usp21 PE=2 SV=1 43 404 8.0E-16
sp|Q9UUD6|UBP11_SCHPO Ubiquitin carboxyl-terminal hydrolase 11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubp11 PE=3 SV=1 5 406 3.0E-15
sp|Q70CQ3|UBP30_HUMAN Ubiquitin carboxyl-terminal hydrolase 30 OS=Homo sapiens GN=USP30 PE=1 SV=1 25 570 2.0E-14
sp|P36026|UBP11_YEAST Ubiquitin carboxyl-terminal hydrolase 11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBP11 PE=3 SV=1 41 399 2.0E-14
sp|Q9FPS0|UBP27_ARATH Ubiquitin carboxyl-terminal hydrolase 27 OS=Arabidopsis thaliana GN=UBP27 PE=2 SV=1 44 403 4.0E-13
sp|A4QNN3|UBP30_XENTR Ubiquitin carboxyl-terminal hydrolase 30 OS=Xenopus tropicalis GN=usp30 PE=2 SV=1 25 570 6.0E-12
sp|Q9HFS7|UBP4_KLULA Ubiquitin carboxyl-terminal hydrolase 4 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DOA4 PE=3 SV=1 43 402 3.0E-10
sp|Q6FQF0|UBP4_CANGA Ubiquitin carboxyl-terminal hydrolase 4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DOA4 PE=3 SV=1 43 271 3.0E-08
sp|Q9VRP5|UBP36_DROME Ubiquitin carboxyl-terminal hydrolase 36 OS=Drosophila melanogaster GN=scny PE=1 SV=3 44 286 2.0E-07
sp|B4QIS3|UBP36_DROSI Ubiquitin carboxyl-terminal hydrolase 36 OS=Drosophila simulans GN=Usp36 PE=3 SV=1 44 286 3.0E-07
sp|B4HUI5|UBP36_DROSE Ubiquitin carboxyl-terminal hydrolase 36 OS=Drosophila sechellia GN=Usp36 PE=3 SV=1 44 271 4.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0004843 cysteine-type deubiquitinase activity Yes
GO:0016579 protein deubiquitination Yes
GO:0006807 nitrogen compound metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0008233 peptidase activity No
GO:0008150 biological_process No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No
GO:0006508 proteolysis No
GO:0070646 protein modification by small protein removal No
GO:0140096 catalytic activity, acting on a protein No
GO:0036211 protein modification process No
GO:0019783 ubiquitin-like protein peptidase activity No
GO:1901564 organonitrogen compound metabolic process No
GO:0003824 catalytic activity No
GO:0071704 organic substance metabolic process No
GO:0101005 deubiquitinase activity No
GO:0043412 macromolecule modification No
GO:0008234 cysteine-type peptidase activity No
GO:0008152 metabolic process No
GO:0070647 protein modification by small protein conjugation or removal No
GO:0044238 primary metabolic process No
GO:0019538 protein metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2950
MQDKSTTVLSYAAGASLAAVALIYVFGPTFALDHEASGKKTIIGLQNQANDCFINSVLQALAGLGDLRIYLIRET
HRRNIQDAAVYANLAQPRDGSRLPEWRLQGLQDGIVTQGLKDMLDALNERPIARKSISPFPFVRVLETAFRQRIS
RQQQDAQEFLQIVAERLKDEYHAGERARQYARMPDAERPQSRLNNGCQGAPLEAEDGFPMEGKYESHVQCQTCRY
KTKPKQETFCTLTLAVPHASSTSLLSCFDGIFKTEYINDFKCEMCRLLQTKATLEHELARSTSEAFRLRACDSID
KLRTAIETDPENPPNNVELADMRYSPKRTIAKTTRMTVFPKILALHLSRSIYGAGQTTVKNSAKVAFPEHLMLGG
LADQRRYRLLAIITHQGGHNSGHYEAFRRQNQPPPYPNANTFQPSGAYSKTVTPDLSARAPTGSPAISTSDLLSA
TPGPGDSSRPSLESSLAPPRSAPEAIHSDGRDKAGSGDASSLRSVAASTRSALSRLASPARHSNQQESNSGVPLL
KSQLGRRKRKSPADKWWRVSDEKVREAKTSEVLDMQREVYMLFYELEEPVS*
Coding >OphauB2|2950
ATGCAAGACAAATCGACCACGGTCCTATCGTATGCTGCCGGAGCCTCACTTGCCGCCGTTGCCCTCATCTACGTC
TTTGGACCGACCTTTGCCCTCGATCATGAGGCCAGCGGCAAAAAGACAATTATTGGCCTGCAGAACCAGGCCAAC
GATTGCTTTATAAACTCGGTTCTGCAAGCCCTTGCTGGTCTCGGGGACCTGCGCATCTACTTGATTCGCGAAACC
CATCGCCGCAATATTCAAGATGCGGCCGTGTACGCCAATCTGGCCCAGCCCCGAGACGGCTCGAGGCTCCCAGAA
TGGCGCCTCCAAGGGCTGCAGGACGGCATTGTGACACAAGGACTCAAGGACATGCTCGATGCTCTTAATGAGCGG
CCCATTGCACGCAAGTCGATATCTCCCTTCCCCTTTGTCCGTGTACTCGAGACGGCCTTTCGGCAGCGCATCAGT
CGACAGCAGCAGGACGCTCAAGAGTTCCTGCAGATTGTCGCTGAGCGACTCAAGGACGAGTATCATGCTGGCGAG
CGCGCGCGCCAGTATGCGCGCATGCCTGACGCGGAAAGGCCGCAATCACGACTAAACAATGGTTGCCAAGGTGCG
CCGCTTGAGGCCGAGGACGGCTTTCCCATGGAGGGCAAGTATGAGTCCCACGTACAGTGCCAGACTTGCCGCTAC
AAGACCAAGCCCAAGCAGGAGACGTTTTGCACCTTGACGCTTGCCGTCCCGCACGCGTCGTCAACCTCGCTTCTC
TCGTGCTTTGACGGCATCTTCAAGACCGAGTACATCAACGACTTCAAGTGTGAAATGTGTCGCCTGCTGCAGACA
AAGGCCACGCTGGAGCACGAGCTGGCTCGGTCCACGTCGGAAGCCTTTCGCCTCCGTGCGTGCGACTCGATTGAC
AAGCTGCGCACGGCCATTGAGACGGATCCCGAGAACCCGCCCAACAACGTCGAGCTGGCCGACATGCGCTACTCA
CCCAAGCGCACCATTGCCAAGACGACGCGCATGACTGTCTTCCCCAAGATTCTTGCCCTTCACCTTTCGCGTTCC
ATCTACGGCGCCGGACAGACGACGGTCAAGAACTCGGCAAAAGTGGCTTTCCCAGAGCACCTCATGCTGGGCGGA
CTGGCCGACCAGCGTCGGTACAGGTTGCTGGCCATCATCACCCACCAAGGGGGCCACAACAGTGGCCATTATGAG
GCCTTTCGGCGGCAGAACCAGCCTCCGCCATACCCCAATGCCAACACGTTCCAGCCGTCTGGTGCGTACAGTAAG
ACGGTGACGCCCGACTTGTCGGCGCGCGCCCCCACGGGCAGCCCAGCCATATCGACGTCGGATCTGCTCTCGGCG
ACGCCCGGCCCAGGCGACTCGTCACGGCCGTCTCTTGAGTCATCGCTTGCGCCGCCGCGCAGTGCCCCCGAAGCC
ATACACTCAGACGGCAGGGACAAGGCTGGCAGCGGAGATGCGAGCAGCCTGCGCTCCGTTGCAGCCTCTACCAGG
TCGGCATTGTCACGGCTGGCCTCTCCTGCGCGCCACTCGAATCAACAAGAGAGCAATAGTGGCGTGCCATTGCTC
AAGTCTCAACTGGGCAGGAGGAAACGCAAGTCTCCGGCCGACAAGTGGTGGCGCGTCAGCGACGAAAAGGTTCGC
GAAGCCAAGACGAGCGAGGTACTGGACATGCAGCGCGAGGTCTACATGCTCTTCTACGAGCTCGAAGAGCCCGTG
TCTTGA
Transcript >OphauB2|2950
ATGCAAGACAAATCGACCACGGTCCTATCGTATGCTGCCGGAGCCTCACTTGCCGCCGTTGCCCTCATCTACGTC
TTTGGACCGACCTTTGCCCTCGATCATGAGGCCAGCGGCAAAAAGACAATTATTGGCCTGCAGAACCAGGCCAAC
GATTGCTTTATAAACTCGGTTCTGCAAGCCCTTGCTGGTCTCGGGGACCTGCGCATCTACTTGATTCGCGAAACC
CATCGCCGCAATATTCAAGATGCGGCCGTGTACGCCAATCTGGCCCAGCCCCGAGACGGCTCGAGGCTCCCAGAA
TGGCGCCTCCAAGGGCTGCAGGACGGCATTGTGACACAAGGACTCAAGGACATGCTCGATGCTCTTAATGAGCGG
CCCATTGCACGCAAGTCGATATCTCCCTTCCCCTTTGTCCGTGTACTCGAGACGGCCTTTCGGCAGCGCATCAGT
CGACAGCAGCAGGACGCTCAAGAGTTCCTGCAGATTGTCGCTGAGCGACTCAAGGACGAGTATCATGCTGGCGAG
CGCGCGCGCCAGTATGCGCGCATGCCTGACGCGGAAAGGCCGCAATCACGACTAAACAATGGTTGCCAAGGTGCG
CCGCTTGAGGCCGAGGACGGCTTTCCCATGGAGGGCAAGTATGAGTCCCACGTACAGTGCCAGACTTGCCGCTAC
AAGACCAAGCCCAAGCAGGAGACGTTTTGCACCTTGACGCTTGCCGTCCCGCACGCGTCGTCAACCTCGCTTCTC
TCGTGCTTTGACGGCATCTTCAAGACCGAGTACATCAACGACTTCAAGTGTGAAATGTGTCGCCTGCTGCAGACA
AAGGCCACGCTGGAGCACGAGCTGGCTCGGTCCACGTCGGAAGCCTTTCGCCTCCGTGCGTGCGACTCGATTGAC
AAGCTGCGCACGGCCATTGAGACGGATCCCGAGAACCCGCCCAACAACGTCGAGCTGGCCGACATGCGCTACTCA
CCCAAGCGCACCATTGCCAAGACGACGCGCATGACTGTCTTCCCCAAGATTCTTGCCCTTCACCTTTCGCGTTCC
ATCTACGGCGCCGGACAGACGACGGTCAAGAACTCGGCAAAAGTGGCTTTCCCAGAGCACCTCATGCTGGGCGGA
CTGGCCGACCAGCGTCGGTACAGGTTGCTGGCCATCATCACCCACCAAGGGGGCCACAACAGTGGCCATTATGAG
GCCTTTCGGCGGCAGAACCAGCCTCCGCCATACCCCAATGCCAACACGTTCCAGCCGTCTGGTGCGTACAGTAAG
ACGGTGACGCCCGACTTGTCGGCGCGCGCCCCCACGGGCAGCCCAGCCATATCGACGTCGGATCTGCTCTCGGCG
ACGCCCGGCCCAGGCGACTCGTCACGGCCGTCTCTTGAGTCATCGCTTGCGCCGCCGCGCAGTGCCCCCGAAGCC
ATACACTCAGACGGCAGGGACAAGGCTGGCAGCGGAGATGCGAGCAGCCTGCGCTCCGTTGCAGCCTCTACCAGG
TCGGCATTGTCACGGCTGGCCTCTCCTGCGCGCCACTCGAATCAACAAGAGAGCAATAGTGGCGTGCCATTGCTC
AAGTCTCAACTGGGCAGGAGGAAACGCAAGTCTCCGGCCGACAAGTGGTGGCGCGTCAGCGACGAAAAGGTTCGC
GAAGCCAAGACGAGCGAGGTACTGGACATGCAGCGCGAGGTCTACATGCTCTTCTACGAGCTCGAAGAGCCCGTG
TCTTGA
Gene >OphauB2|2950
ATGCAAGACAAATCGACCACGGTCCTATCGTATGCTGCCGGAGCCTCACTTGCCGCCGTTGCCCTCATCTACGTC
TTTGGACCGACCTTTGCCCTCGATCATGAGGCCAGCGGCAAAAAGACAATTATTGGCCTGCAGAACCAGGCCAAC
GATTGCTTTATAAACTCGGTTCTGCAAGCCCTTGCTGGTCTCGGGGACCTGCGCATCTACTTGATTCGCGAAACC
CATCGCCGCAATATTCAAGATGCGGCCGTGTACGCCAATCTGGCCCAGCCCCGAGACGGCTCGAGGCTCCCAGAA
TGGCGCCTCCAAGGGCTGCAGGACGGCATTGTGACACAAGGACTCAAGGACATGCTCGATGCTCTTAATGAGCGG
CCCATTGCACGCAAGTCGATATCTCCCTTCCCCTTTGTCCGTGTACTCGAGACGGCCTTTCGGCAGCGCATCAGT
CGACAGCAGCAGGACGCTCAAGAGTTCCTGCAGATTGTCGCTGAGCGACTCAAGGACGAGTATCATGCTGGCGAG
CGCGCGCGCCAGTATGCGCGCATGCCTGACGCGGAAAGGCCGCAATCACGACTAAACAATGGTTGCCAAGGTGCG
CCGCTTGAGGCCGAGGACGGCTTTCCCATGGAGGGCAAGTATGAGTCCCACGTACAGTGCCAGACTTGCCGCTAC
AAGACCAAGCCCAAGCAGGAGACGTTTTGCACCTTGACGCTTGCCGTCCCGCACGCGTCGTCAACCTCGCTTCTC
TCGTGCTTTGACGGCATCTTCAAGACCGAGTACATCAACGACTTCAAGTGTGAAATGTGTCGCCTGCTGCAGACA
AAGGCCACGCTGGAGCACGAGCTGGCTCGGTCCACGTCGGAAGCCTTTCGCCTCCGTGCGTGCGACTCGATTGAC
AAGCTGCGCACGGCCATTGAGACGGATCCCGAGAACCCGCCCAACAACGTCGAGCTGGCCGACATGCGCTACTCA
CCCAAGCGCACCATTGCCAAGACGACGCGCATGACTGTCTTCCCCAAGATTCTTGCCCTTCACCTTTCGCGTTCC
ATCTACGGCGCCGGACAGACGACGGTCAAGAACTCGGCAAAAGTGGCTTTCCCAGAGCACCTCATGCTGGGCGGA
CTGGCCGACCAGCGTCGGTACAGGTTGCTGGCCATCATCACCCACCAAGGGGGCCACAACAGTGGCCATTATGAG
GCCTTTCGGCGGCAGAACCAGCCTCCGCCATACCCCAATGCCAACACGTTCCAGCCGTCTGGTGCGTACAGTAAG
ACGGTGACGCCCGACTTGTCGGCGCGCGCCCCCACGGGCAGCCCAGCCATATCGACGTCGGATCTGCTCTCGGCG
ACGCCCGGCCCAGGCGACTCGTCACGGCCGTCTCTTGAGTCATCGCTTGCGCCGCCGCGCAGTGCCCCCGAAGCC
ATACACTCAGACGGCAGGGACAAGGCTGGCAGCGGAGATGCGAGCAGCCTGCGCTCCGTTGCAGCCTCTACCAGG
TCGGCATTGTCACGGCTGGCCTCTCCTGCGCGCCACTCGAATCAACAAGAGAGCAATAGTGGCGTGCCATTGCTC
AAGTCTCAACTGGGCAGGAGGAAACGCAAGTCTCCGGCCGACAAGTGGTGGCGCGTCAGCGACGAAAAGGTTCGC
GAAGCCAAGACGAGCGAGGTACTGGACATGCAGCGCGAGGTCTACATGCTCTTCTACGAGCTCGAAGAGCCCGTG
TCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail