Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2937
Gene name
LocationContig_2:110355..111469
Strand+
Gene length (bp)1114
Transcript length (bp)909
Coding sequence length (bp)909
Protein length (aa) 303

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14327 CSTF2_hinge Hinge domain of cleavage stimulation factor subunit 2 6.1E-32 124 203
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 9.9E-21 10 80
PF14304 CSTF_C Transcription termination and cleavage factor C-terminal 2.0E-10 261 294

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8BIQ5|CSTF2_MOUSE Cleavage stimulation factor subunit 2 OS=Mus musculus GN=Cstf2 PE=1 SV=2 8 198 6.0E-39
sp|Q8HXM1|CSTF2_BOVIN Cleavage stimulation factor subunit 2 OS=Bos taurus GN=CSTF2 PE=2 SV=1 8 198 7.0E-39
sp|P33240|CSTF2_HUMAN Cleavage stimulation factor subunit 2 OS=Homo sapiens GN=CSTF2 PE=1 SV=1 8 198 9.0E-39
sp|Q5RDA3|CSTF2_PONAB Cleavage stimulation factor subunit 2 OS=Pongo abelii GN=CSTF2 PE=2 SV=1 8 198 1.0E-38
sp|Q9H0L4|CSTFT_HUMAN Cleavage stimulation factor subunit 2 tau variant OS=Homo sapiens GN=CSTF2T PE=1 SV=1 8 198 4.0E-37
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8BIQ5|CSTF2_MOUSE Cleavage stimulation factor subunit 2 OS=Mus musculus GN=Cstf2 PE=1 SV=2 8 198 6.0E-39
sp|Q8HXM1|CSTF2_BOVIN Cleavage stimulation factor subunit 2 OS=Bos taurus GN=CSTF2 PE=2 SV=1 8 198 7.0E-39
sp|P33240|CSTF2_HUMAN Cleavage stimulation factor subunit 2 OS=Homo sapiens GN=CSTF2 PE=1 SV=1 8 198 9.0E-39
sp|Q5RDA3|CSTF2_PONAB Cleavage stimulation factor subunit 2 OS=Pongo abelii GN=CSTF2 PE=2 SV=1 8 198 1.0E-38
sp|Q9H0L4|CSTFT_HUMAN Cleavage stimulation factor subunit 2 tau variant OS=Homo sapiens GN=CSTF2T PE=1 SV=1 8 198 4.0E-37
sp|Q8C7E9|CSTFT_MOUSE Cleavage stimulation factor subunit 2 tau variant OS=Mus musculus GN=Cstf2t PE=1 SV=2 8 198 9.0E-37
sp|Q9P6P7|YKCG_SCHPO Uncharacterized RNA-binding protein C644.16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC644.16 PE=3 SV=1 6 209 2.0E-35
sp|Q9M9G6|CTF64_ARATH Cleavage stimulating factor 64 OS=Arabidopsis thaliana GN=CSTF64 PE=1 SV=1 8 240 4.0E-34
sp|P25299|RNA15_YEAST mRNA 3'-end-processing protein RNA15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RNA15 PE=1 SV=1 1 299 1.0E-24
sp|O43040|CTF1_SCHPO Cleavage and termination factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ctf1 PE=1 SV=1 9 146 4.0E-21
sp|P19683|ROC4_NICSY 31 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1 4 87 1.0E-12
sp|Q5RC80|RBM39_PONAB RNA-binding protein 39 OS=Pongo abelii GN=RBM39 PE=2 SV=1 10 87 1.0E-12
sp|Q14498|RBM39_HUMAN RNA-binding protein 39 OS=Homo sapiens GN=RBM39 PE=1 SV=2 10 87 1.0E-12
sp|Q8VH51|RBM39_MOUSE RNA-binding protein 39 OS=Mus musculus GN=Rbm39 PE=1 SV=2 10 87 1.0E-12
sp|Q9LIS2|RBG4_ARATH Glycine-rich RNA-binding protein 4, mitochondrial OS=Arabidopsis thaliana GN=RBG4 PE=2 SV=1 4 89 2.0E-12
sp|Q86U06|RBM23_HUMAN Probable RNA-binding protein 23 OS=Homo sapiens GN=RBM23 PE=1 SV=1 10 93 2.0E-12
sp|Q04836|CP31A_ARATH 31 kDa ribonucleoprotein, chloroplastic OS=Arabidopsis thaliana GN=CP31A PE=1 SV=1 6 87 3.0E-12
sp|P42696|RBM34_HUMAN RNA-binding protein 34 OS=Homo sapiens GN=RBM34 PE=1 SV=2 7 81 4.0E-12
sp|Q8R0F5|RBMX2_MOUSE RNA-binding motif protein, X-linked 2 OS=Mus musculus GN=Rbmx2 PE=1 SV=1 10 83 7.0E-12
sp|Q9Y388|RBMX2_HUMAN RNA-binding motif protein, X-linked 2 OS=Homo sapiens GN=RBMX2 PE=1 SV=2 10 111 1.0E-11
sp|P28644|ROC1_SPIOL 28 kDa ribonucleoprotein, chloroplastic OS=Spinacia oleracea PE=1 SV=1 3 82 1.0E-11
sp|B0BN49|RBMX2_RAT RNA-binding motif protein, X-linked 2 OS=Rattus norvegicus GN=Rbmx2 PE=2 SV=1 10 83 2.0E-11
sp|Q9WX37|RBPE_NOSS1 Putative RNA-binding protein RbpE OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpE PE=3 SV=3 10 82 2.0E-11
sp|Q9ZUU4|CP29B_ARATH RNA-binding protein CP29B, chloroplastic OS=Arabidopsis thaliana GN=CP29B PE=1 SV=1 10 82 3.0E-11
sp|Q9ZUU4|CP29B_ARATH RNA-binding protein CP29B, chloroplastic OS=Arabidopsis thaliana GN=CP29B PE=1 SV=1 10 81 5.0E-11
sp|P41891|GAR2_SCHPO Protein gar2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gar2 PE=1 SV=2 6 84 5.0E-11
sp|Q98SJ2|DAZP1_XENLA DAZ-associated protein 1 OS=Xenopus laevis GN=dazap1 PE=1 SV=1 7 136 6.0E-11
sp|Q44554|RBPB_NOSS1 Putative RNA-binding protein RbpB OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpB PE=3 SV=3 10 82 6.0E-11
sp|P19682|ROC3_NICSY 28 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1 6 87 9.0E-11
sp|P49313|ROC1_NICPL 30 kDa ribonucleoprotein, chloroplastic OS=Nicotiana plumbaginifolia PE=2 SV=1 10 81 9.0E-11
sp|Q08935|ROC1_NICSY 29 kDa ribonucleoprotein A, chloroplastic OS=Nicotiana sylvestris PE=2 SV=1 10 81 1.0E-10
sp|Q08935|ROC1_NICSY 29 kDa ribonucleoprotein A, chloroplastic OS=Nicotiana sylvestris PE=2 SV=1 6 82 1.0E-10
sp|Q57014|RBPA_SYNY3 Putative RNA-binding protein RbpA OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=rbpA PE=3 SV=3 10 82 1.0E-10
sp|P82277|RRP2_SPIOL 30S ribosomal protein 2, chloroplastic OS=Spinacia oleracea GN=PSRP2 PE=1 SV=1 7 92 1.0E-10
sp|Q9FNR1|RBG3_ARATH Glycine-rich RNA-binding protein 3, mitochondrial OS=Arabidopsis thaliana GN=RBG3 PE=2 SV=1 6 87 2.0E-10
sp|Q9P3U1|YKX5_SCHPO Uncharacterized RNA-binding protein C328.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC328.05 PE=3 SV=3 5 85 2.0E-10
sp|Q9SVM8|RBG2_ARATH Glycine-rich RNA-binding protein 2, mitochondrial OS=Arabidopsis thaliana GN=RBG2 PE=1 SV=1 2 89 2.0E-10
sp|Q39061|CP33_ARATH RNA-binding protein CP33, chloroplastic OS=Arabidopsis thaliana GN=CP33 PE=2 SV=1 10 93 3.0E-10
sp|Q44556|RBPD_NOSS1 Putative RNA-binding protein RbpD OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpD PE=3 SV=3 10 93 4.0E-10
sp|O94290|IST3_SCHPO U2 snRNP component ist3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf29 PE=1 SV=1 10 82 5.0E-10
sp|P53883|NOP13_YEAST Nucleolar protein 13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NOP13 PE=1 SV=2 1 83 6.0E-10
sp|Q9FGS0|CP31B_ARATH RNA-binding protein CP31B, chloroplastic OS=Arabidopsis thaliana GN=CP31B PE=1 SV=1 5 82 6.0E-10
sp|Q9WX39|RBPF_NOSS1 Putative RNA-binding protein RbpF OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpF PE=3 SV=3 10 82 6.0E-10
sp|Q8C5L7|RBM34_MOUSE RNA-binding protein 34 OS=Mus musculus GN=Rbm34 PE=1 SV=1 7 81 6.0E-10
sp|Q08937|ROC2_NICSY 29 kDa ribonucleoprotein B, chloroplastic OS=Nicotiana sylvestris PE=2 SV=1 7 87 7.0E-10
sp|Q5M9F1|RBM34_RAT RNA-binding protein 34 OS=Rattus norvegicus GN=Rbm34 PE=1 SV=1 7 81 7.0E-10
sp|Q96EP5|DAZP1_HUMAN DAZ-associated protein 1 OS=Homo sapiens GN=DAZAP1 PE=1 SV=1 7 119 8.0E-10
sp|Q10B98|C3H25_ORYSJ Zinc finger CCCH domain-containing protein 25 OS=Oryza sativa subsp. japonica GN=Os03g0826400 PE=2 SV=1 10 82 9.0E-10
sp|P40561|SGN1_YEAST RNA-binding protein SGN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGN1 PE=1 SV=1 7 81 9.0E-10
sp|Q9JII5|DAZP1_MOUSE DAZ-associated protein 1 OS=Mus musculus GN=Dazap1 PE=1 SV=2 7 81 9.0E-10
sp|P49314|ROC2_NICPL 31 kDa ribonucleoprotein, chloroplastic OS=Nicotiana plumbaginifolia PE=2 SV=1 7 87 1.0E-09
sp|P49313|ROC1_NICPL 30 kDa ribonucleoprotein, chloroplastic OS=Nicotiana plumbaginifolia PE=2 SV=1 6 82 2.0E-09
sp|Q08937|ROC2_NICSY 29 kDa ribonucleoprotein B, chloroplastic OS=Nicotiana sylvestris PE=2 SV=1 10 82 2.0E-09
sp|Q09100|RNP24_SCHPO RNA-binding protein rnp24 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rnp24 PE=3 SV=2 2 66 2.0E-09
sp|P19684|ROC5_NICSY 33 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1 10 83 2.0E-09
sp|Q1DXH0|PABP_COCIM Polyadenylate-binding protein, cytoplasmic and nuclear OS=Coccidioides immitis (strain RS) GN=PAB1 PE=3 SV=1 10 81 2.0E-09
sp|Q43349|CP29A_ARATH 29 kDa ribonucleoprotein, chloroplastic OS=Arabidopsis thaliana GN=CP29A PE=2 SV=2 10 81 2.0E-09
sp|O43040|CTF1_SCHPO Cleavage and termination factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ctf1 PE=1 SV=1 117 294 3.0E-09
sp|Q3SZM1|MK67I_BOVIN MKI67 FHA domain-interacting nucleolar phosphoprotein OS=Bos taurus GN=NIFK PE=2 SV=1 4 83 3.0E-09
sp|P28644|ROC1_SPIOL 28 kDa ribonucleoprotein, chloroplastic OS=Spinacia oleracea PE=1 SV=1 6 87 4.0E-09
sp|Q43349|CP29A_ARATH 29 kDa ribonucleoprotein, chloroplastic OS=Arabidopsis thaliana GN=CP29A PE=2 SV=2 6 82 5.0E-09
sp|Q44560|RBPA_NOSS1 Putative RNA-binding protein RbpA OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpA PE=3 SV=3 10 82 5.0E-09
sp|Q24562|U2AF2_DROME Splicing factor U2AF 50 kDa subunit OS=Drosophila melanogaster GN=U2af50 PE=1 SV=1 10 208 5.0E-09
sp|P10979|GRPA_MAIZE Glycine-rich RNA-binding, abscisic acid-inducible protein OS=Zea mays GN=RAB15 PE=1 SV=1 10 82 7.0E-09
sp|Q56JZ7|ZCRB1_BOVIN Zinc finger CCHC-type and RNA-binding motif-containing protein 1 OS=Bos taurus GN=ZCRB1 PE=2 SV=1 5 80 9.0E-09
sp|P49314|ROC2_NICPL 31 kDa ribonucleoprotein, chloroplastic OS=Nicotiana plumbaginifolia PE=2 SV=1 10 82 1.0E-08
sp|Q5AI15|PABP_CANAL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PAB1 PE=3 SV=1 10 81 1.0E-08
sp|Q04836|CP31A_ARATH 31 kDa ribonucleoprotein, chloroplastic OS=Arabidopsis thaliana GN=CP31A PE=1 SV=1 10 82 2.0E-08
sp|Q6DJI9|ZCRB1_XENLA Zinc finger CCHC-type and RNA-binding motif-containing protein 1 OS=Xenopus laevis GN=zcrb1 PE=2 SV=1 5 80 2.0E-08
sp|P31209|PABP_SCHPO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pab1 PE=1 SV=2 10 81 2.0E-08
sp|Q9C909|RBG5_ARATH Glycine-rich RNA-binding protein 5, mitochondrial OS=Arabidopsis thaliana GN=RBG5 PE=2 SV=1 7 86 2.0E-08
sp|Q6BI95|PABP_DEBHA Polyadenylate-binding protein, cytoplasmic and nuclear OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PAB1 PE=3 SV=2 10 81 2.0E-08
sp|P19683|ROC4_NICSY 31 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1 10 82 3.0E-08
sp|P19682|ROC3_NICSY 28 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1 10 82 3.0E-08
sp|A8WLV5|EIF3G_CAEBR Eukaryotic translation initiation factor 3 subunit G OS=Caenorhabditis briggsae GN=eif-3.G.1 PE=3 SV=2 3 84 3.0E-08
sp|Q8TBF4|ZCRB1_HUMAN Zinc finger CCHC-type and RNA-binding motif-containing protein 1 OS=Homo sapiens GN=ZCRB1 PE=1 SV=2 5 80 3.0E-08
sp|Q19706|EIF3G_CAEEL Eukaryotic translation initiation factor 3 subunit G OS=Caenorhabditis elegans GN=eif-3.G PE=3 SV=2 3 84 3.0E-08
sp|Q9FGS0|CP31B_ARATH RNA-binding protein CP31B, chloroplastic OS=Arabidopsis thaliana GN=CP31B PE=1 SV=1 10 87 4.0E-08
sp|Q2HJG2|PUF60_BOVIN Poly(U)-binding-splicing factor PUF60 OS=Bos taurus GN=PUF60 PE=2 SV=1 10 81 4.0E-08
sp|A5DW14|PABP_LODEL Polyadenylate-binding protein, cytoplasmic and nuclear OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=PAB1 PE=3 SV=1 10 81 4.0E-08
sp|Q9UHX1|PUF60_HUMAN Poly(U)-binding-splicing factor PUF60 OS=Homo sapiens GN=PUF60 PE=1 SV=1 10 81 4.0E-08
sp|Q5R469|PUF60_PONAB Poly(U)-binding-splicing factor PUF60 OS=Pongo abelii GN=PUF60 PE=2 SV=1 10 81 4.0E-08
sp|Q9WV25|PUF60_RAT Poly(U)-binding-splicing factor PUF60 OS=Rattus norvegicus GN=Puf60 PE=2 SV=2 10 81 4.0E-08
sp|Q3UEB3|PUF60_MOUSE Poly(U)-binding-splicing factor PUF60 OS=Mus musculus GN=Puf60 PE=1 SV=2 10 81 4.0E-08
sp|P15771|NUCL_CHICK Nucleolin OS=Gallus gallus GN=NCL PE=1 SV=1 7 84 4.0E-08
sp|P26369|U2AF2_MOUSE Splicing factor U2AF 65 kDa subunit OS=Mus musculus GN=U2af2 PE=1 SV=3 10 81 5.0E-08
sp|Q39061|CP33_ARATH RNA-binding protein CP33, chloroplastic OS=Arabidopsis thaliana GN=CP33 PE=2 SV=1 10 88 6.0E-08
sp|P26368|U2AF2_HUMAN Splicing factor U2AF 65 kDa subunit OS=Homo sapiens GN=U2AF2 PE=1 SV=4 10 81 6.0E-08
sp|Q9CZ96|ZCRB1_MOUSE Zinc finger CCHC-type and RNA-binding motif-containing protein 1 OS=Mus musculus GN=Zcrb1 PE=1 SV=1 5 80 6.0E-08
sp|Q499V6|ZCRB1_RAT Zinc finger CCHC-type and RNA-binding motif-containing protein 1 OS=Rattus norvegicus GN=Zcrb1 PE=2 SV=1 5 80 6.0E-08
sp|Q9FJN9|PABN2_ARATH Polyadenylate-binding protein 2 OS=Arabidopsis thaliana GN=PABN2 PE=1 SV=1 7 81 7.0E-08
sp|Q03878|GRP1_DAUCA Glycine-rich RNA-binding protein OS=Daucus carota PE=2 SV=1 10 82 7.0E-08
sp|Q9SD61|C3H42_ARATH Zinc finger CCCH domain-containing protein 42 OS=Arabidopsis thaliana GN=At3g47120 PE=2 SV=1 10 105 7.0E-08
sp|Q9ZR39|U2A2A_NICPL Splicing factor U2af large subunit A OS=Nicotiana plumbaginifolia GN=U2AF65A PE=2 SV=1 6 86 7.0E-08
sp|Q0CR95|PABP_ASPTN Polyadenylate-binding protein, cytoplasmic and nuclear OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=pab1 PE=3 SV=1 10 81 8.0E-08
sp|O89086|RBM3_MOUSE RNA-binding protein 3 OS=Mus musculus GN=Rbm3 PE=1 SV=1 10 82 9.0E-08
sp|Q177H0|NCBP2_AEDAE Nuclear cap-binding protein subunit 2 OS=Aedes aegypti GN=Cbp20 PE=3 SV=1 10 83 9.0E-08
sp|Q8IY67|RAVR1_HUMAN Ribonucleoprotein PTB-binding 1 OS=Homo sapiens GN=RAVER1 PE=1 SV=1 4 85 1.0E-07
sp|P08199|NUCL_MESAU Nucleolin OS=Mesocricetus auratus GN=NCL PE=1 SV=2 6 85 1.0E-07
sp|Q9SIX3|RBG1_ARATH Probable glycine-rich RNA-binding protein 1 OS=Arabidopsis thaliana GN=RBG1 PE=2 SV=2 10 79 1.0E-07
sp|Q9NEW6|RSP3_CAEEL Probable splicing factor, arginine/serine-rich 3 OS=Caenorhabditis elegans GN=rsp-3 PE=1 SV=2 10 84 1.0E-07
sp|Q5BGA9|MRD1_EMENI Multiple RNA-binding domain-containing protein 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mrd1 PE=3 SV=1 10 100 1.0E-07
sp|Q7XTT4|NUCL2_ORYSJ Nucleolin 2 OS=Oryza sativa subsp. japonica GN=Os04g0620700 PE=2 SV=2 7 87 1.0E-07
sp|Q91WT8|RBM47_MOUSE RNA-binding protein 47 OS=Mus musculus GN=Rbm47 PE=1 SV=1 10 84 1.0E-07
sp|P09405|NUCL_MOUSE Nucleolin OS=Mus musculus GN=Ncl PE=1 SV=2 6 85 1.0E-07
sp|Q66H68|RBM47_RAT RNA-binding protein 47 OS=Rattus norvegicus GN=Rbm47 PE=2 SV=1 10 84 1.0E-07
sp|Q0P4R6|RBM46_XENTR Probable RNA-binding protein 46 OS=Xenopus tropicalis GN=rbm46 PE=2 SV=1 10 79 1.0E-07
sp|Q2R0Q1|U2A2A_ORYSJ Splicing factor U2af large subunit A OS=Oryza sativa subsp. japonica GN=U2AF65A PE=2 SV=2 6 89 1.0E-07
sp|P13383|NUCL_RAT Nucleolin OS=Rattus norvegicus GN=Ncl PE=1 SV=3 6 85 2.0E-07
sp|Q5RF83|CIRBP_PONAB Cold-inducible RNA-binding protein OS=Pongo abelii GN=CIRBP PE=2 SV=1 10 82 2.0E-07
sp|Q14011|CIRBP_HUMAN Cold-inducible RNA-binding protein OS=Homo sapiens GN=CIRBP PE=1 SV=1 10 82 2.0E-07
sp|Q5R5P4|RBM47_PONAB RNA-binding protein 47 OS=Pongo abelii GN=RBM47 PE=2 SV=2 10 84 2.0E-07
sp|A0AV96|RBM47_HUMAN RNA-binding protein 47 OS=Homo sapiens GN=RBM47 PE=1 SV=2 10 84 2.0E-07
sp|Q9DED4|CIRBB_XENLA Cold-inducible RNA-binding protein B OS=Xenopus laevis GN=cirbp-b PE=1 SV=1 10 82 2.0E-07
sp|P19338|NUCL_HUMAN Nucleolin OS=Homo sapiens GN=NCL PE=1 SV=3 6 85 2.0E-07
sp|Q5RF26|NUCL_PONAB Nucleolin OS=Pongo abelii GN=NCL PE=2 SV=3 6 85 2.0E-07
sp|Q74ZS6|PABP_ASHGO Polyadenylate-binding protein, cytoplasmic and nuclear OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PAB1 PE=3 SV=1 10 81 2.0E-07
sp|Q91584|ELAV3_XENLA ELAV-like protein 3 OS=Xenopus laevis GN=elavl3 PE=2 SV=1 10 84 2.0E-07
sp|Q4R4J7|NUCL_MACFA Nucleolin OS=Macaca fascicularis GN=NCL PE=2 SV=3 6 85 2.0E-07
sp|Q4R2Z0|RBM46_MACFA Probable RNA-binding protein 46 OS=Macaca fascicularis GN=RBM46 PE=2 SV=2 10 74 2.0E-07
sp|W8E7I1|RBM3_CAPHI RNA-binding protein 3 OS=Capra hircus GN=RBM3 PE=2 SV=2 10 82 2.0E-07
sp|Q28FX0|ELAV3_XENTR ELAV-like protein 3 OS=Xenopus tropicalis GN=elavl3 PE=2 SV=1 10 84 2.0E-07
sp|Q28GD4|ELAV2_XENTR ELAV-like protein 2 OS=Xenopus tropicalis GN=elavl2 PE=2 SV=2 10 84 2.0E-07
sp|Q2QZL4|U2A2B_ORYSJ Splicing factor U2af large subunit B OS=Oryza sativa subsp. japonica GN=U2AF65B PE=3 SV=2 6 86 2.0E-07
sp|P40565|IST3_YEAST U2 snRNP component IST3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IST3 PE=1 SV=1 10 84 2.0E-07
sp|P98179|RBM3_HUMAN RNA-binding protein 3 OS=Homo sapiens GN=RBM3 PE=1 SV=1 10 82 2.0E-07
sp|P86049|RBM46_MOUSE Probable RNA-binding protein 46 OS=Mus musculus GN=Rbm46 PE=1 SV=1 10 74 2.0E-07
sp|Q8TBY0|RBM46_HUMAN Probable RNA-binding protein 46 OS=Homo sapiens GN=RBM46 PE=2 SV=1 10 74 2.0E-07
sp|P60825|CIRBP_RAT Cold-inducible RNA-binding protein OS=Rattus norvegicus GN=Cirbp PE=2 SV=1 10 82 2.0E-07
sp|P60824|CIRBP_MOUSE Cold-inducible RNA-binding protein OS=Mus musculus GN=Cirbp PE=1 SV=1 10 82 2.0E-07
sp|P60826|CIRBP_CRIGR Cold-inducible RNA-binding protein OS=Cricetulus griseus GN=CIRBP PE=2 SV=1 10 82 2.0E-07
sp|Q9ZR40|U2A2B_NICPL Splicing factor U2af large subunit B OS=Nicotiana plumbaginifolia GN=U2AF65B PE=2 SV=1 6 86 2.0E-07
sp|Q9P3U1|YKX5_SCHPO Uncharacterized RNA-binding protein C328.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC328.05 PE=3 SV=3 6 89 3.0E-07
sp|Q6IQE0|PU60B_DANRE Poly(U)-binding-splicing factor PUF60-B OS=Danio rerio GN=puf60b PE=2 SV=2 10 81 3.0E-07
sp|Q99070|GRP2_SORBI Glycine-rich RNA-binding protein 2 OS=Sorghum bicolor GN=GRP2 PE=2 SV=1 10 82 3.0E-07
sp|Q6NVP7|PABP2_XENTR Polyadenylate-binding protein 2 OS=Xenopus tropicalis GN=pabpn1 PE=2 SV=1 7 81 3.0E-07
sp|Q5RJM0|MK67I_RAT MKI67 FHA domain-interacting nucleolar phosphoprotein OS=Rattus norvegicus GN=Nifk PE=2 SV=1 7 98 3.0E-07
sp|A3LXL0|PABP_PICST Polyadenylate-binding protein, cytoplasmic and nuclear OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PAB1 PE=3 SV=1 10 81 3.0E-07
sp|Q7QCB6|NCBP2_ANOGA Nuclear cap-binding protein subunit 2 OS=Anopheles gambiae GN=Cbp20 PE=3 SV=3 7 83 3.0E-07
sp|Q75BJ7|NOP12_ASHGO Nucleolar protein 12 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=NOP12 PE=3 SV=1 7 81 3.0E-07
sp|Q5R9Z6|ELAV2_PONAB ELAV-like protein 2 OS=Pongo abelii GN=ELAVL2 PE=2 SV=1 10 84 3.0E-07
sp|Q12926|ELAV2_HUMAN ELAV-like protein 2 OS=Homo sapiens GN=ELAVL2 PE=1 SV=2 10 84 3.0E-07
sp|Q6DCB7|DND1_XENLA Dead end protein homolog 1 OS=Xenopus laevis GN=dnd1 PE=2 SV=2 10 100 3.0E-07
sp|Q60899|ELAV2_MOUSE ELAV-like protein 2 OS=Mus musculus GN=Elavl2 PE=2 SV=1 10 84 3.0E-07
sp|Q9PTX2|CIRBP_LITCT Cold-inducible RNA-binding protein OS=Lithobates catesbeiana GN=cirbp PE=2 SV=1 10 82 4.0E-07
sp|P57052|RBM11_HUMAN Splicing regulator RBM11 OS=Homo sapiens GN=RBM11 PE=1 SV=1 8 83 4.0E-07
sp|Q2QKB4|U2A2B_WHEAT Splicing factor U2af large subunit B OS=Triticum aestivum GN=U2AF65B PE=2 SV=1 6 86 4.0E-07
sp|Q5SP50|ZCRB1_DANRE Zinc finger CCHC-type and RNA-binding motif-containing protein 1 OS=Danio rerio GN=zcrb1 PE=2 SV=1 5 80 4.0E-07
sp|Q7ZXB8|PAB2B_XENLA Polyadenylate-binding protein 2-B OS=Xenopus laevis GN=pabpn1-b PE=2 SV=1 7 81 5.0E-07
sp|A1D4K4|PABP_NEOFI Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pab1 PE=3 SV=1 10 81 5.0E-07
sp|Q4WK03|PABP_ASPFU Polyadenylate-binding protein, cytoplasmic and nuclear OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pab1 PE=3 SV=1 10 81 5.0E-07
sp|B0BNE4|EPAB2_RAT Embryonic polyadenylate-binding protein 2 OS=Rattus norvegicus GN=Pabpn1l PE=2 SV=1 8 81 5.0E-07
sp|Q9DDY9|PAB2A_XENLA Polyadenylate-binding protein 2-A OS=Xenopus laevis GN=pabpn1-a PE=2 SV=1 7 81 5.0E-07
sp|Q0U6E7|EIF3G_PHANO Eukaryotic translation initiation factor 3 subunit G OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=TIF35 PE=3 SV=2 4 86 5.0E-07
sp|Q6GL69|MK67I_XENTR MKI67 FHA domain-interacting nucleolar phosphoprotein-like OS=Xenopus tropicalis GN=nifk PE=2 SV=1 9 83 5.0E-07
sp|P78795|EIF3G_SCHPO Eukaryotic translation initiation factor 3 subunit G OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tif35 PE=1 SV=2 4 85 5.0E-07
sp|Q8JIY8|MK67I_DANRE MKI67 FHA domain-interacting nucleolar phosphoprotein OS=Danio rerio GN=nifk PE=2 SV=2 9 79 5.0E-07
sp|P26378|ELAV4_HUMAN ELAV-like protein 4 OS=Homo sapiens GN=ELAVL4 PE=1 SV=2 10 84 5.0E-07
sp|Q61701|ELAV4_MOUSE ELAV-like protein 4 OS=Mus musculus GN=Elavl4 PE=1 SV=1 10 84 5.0E-07
sp|Q925G0|RBM3_RAT RNA-binding protein 3 OS=Rattus norvegicus GN=Rbm3 PE=1 SV=2 10 82 5.0E-07
sp|Q7SYS2|MK67I_XENLA MKI67 FHA domain-interacting nucleolar phosphoprotein-like OS=Xenopus laevis GN=nifk PE=2 SV=2 9 83 6.0E-07
sp|Q2QKB3|U2A2A_WHEAT Splicing factor U2af large subunit A OS=Triticum aestivum GN=U2AF65A PE=2 SV=1 10 86 6.0E-07
sp|O09032|ELAV4_RAT ELAV-like protein 4 OS=Rattus norvegicus GN=Elavl4 PE=1 SV=1 10 84 6.0E-07
sp|Q4WJT7|MRD1_ASPFU Multiple RNA-binding domain-containing protein 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mrd1 PE=3 SV=1 10 100 7.0E-07
sp|O74400|YOCE_SCHPO Uncharacterized RNA-binding protein C4F6.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC4F6.14 PE=1 SV=1 9 101 7.0E-07
sp|Q80YT9|RBM11_MOUSE Splicing regulator RBM11 OS=Mus musculus GN=Rbm11 PE=1 SV=1 8 83 7.0E-07
sp|Q8CH84|ELAV2_RAT ELAV-like protein 2 OS=Rattus norvegicus GN=Elavl2 PE=1 SV=1 15 84 7.0E-07
sp|Q60900|ELAV3_MOUSE ELAV-like protein 3 OS=Mus musculus GN=Elavl3 PE=1 SV=1 10 84 7.0E-07
sp|Q05966|GRP10_BRANA Glycine-rich RNA-binding protein 10 OS=Brassica napus GN=GRP10 PE=2 SV=1 10 82 7.0E-07
sp|P27476|NSR1_YEAST Nuclear localization sequence-binding protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NSR1 PE=1 SV=1 9 93 7.0E-07
sp|P53927|NOP15_YEAST Ribosome biogenesis protein 15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NOP15 PE=1 SV=1 7 81 7.0E-07
sp|B5G279|NCBP2_TAEGU Nuclear cap-binding protein subunit 2 OS=Taeniopygia guttata GN=NCBP2 PE=2 SV=1 7 90 8.0E-07
sp|Q14576|ELAV3_HUMAN ELAV-like protein 3 OS=Homo sapiens GN=ELAVL3 PE=2 SV=3 10 84 8.0E-07
sp|P53316|YG5B_YEAST Uncharacterized RNA-binding protein YGR250C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YGR250C PE=1 SV=1 10 88 8.0E-07
sp|Q9CW46|RAVR1_MOUSE Ribonucleoprotein PTB-binding 1 OS=Mus musculus GN=Raver1 PE=1 SV=2 9 85 8.0E-07
sp|Q4G338|PPIE_HAECO Peptidyl-prolyl cis-trans isomerase E OS=Haemonchus contortus PE=1 SV=1 7 84 8.0E-07
sp|O22315|SR34_ARATH Serine/arginine-rich-splicing factor SR34 OS=Arabidopsis thaliana GN=SR34 PE=1 SV=1 1 93 8.0E-07
sp|O23212|U2A2A_ARATH Splicing factor U2af large subunit A OS=Arabidopsis thaliana GN=U2AF65A PE=2 SV=2 6 86 8.0E-07
sp|Q5XI28|RAVR1_RAT Ribonucleoprotein PTB-binding 1 OS=Rattus norvegicus GN=Raver1 PE=1 SV=1 9 85 9.0E-07
sp|A4QUF0|PABP_MAGO7 Polyadenylate-binding protein, cytoplasmic and nuclear OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAB1 PE=3 SV=1 10 81 9.0E-07
sp|Q1ZXC2|PAP1B_DICDI Polyadenylate-binding protein 1-B OS=Dictyostelium discoideum GN=pabpc1B PE=3 SV=1 10 106 9.0E-07
sp|O13845|RSD1_SCHPO RNA-binding protein rsd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rsd1 PE=1 SV=2 6 86 9.0E-07
sp|Q54ZS8|PABP2_DICDI Polyadenylate-binding protein 2 OS=Dictyostelium discoideum GN=pabpn1 PE=3 SV=1 7 81 1.0E-06
sp|O22703|RZ1B_ARATH Glycine-rich RNA-binding protein RZ1B OS=Arabidopsis thaliana GN=RZ1B PE=2 SV=1 10 111 1.0E-06
sp|A6NDY0|EPAB2_HUMAN Embryonic polyadenylate-binding protein 2 OS=Homo sapiens GN=PABPN1L PE=2 SV=1 8 81 1.0E-06
sp|Q28IQ9|CIRBP_XENTR Cold-inducible RNA-binding protein OS=Xenopus tropicalis GN=cirbp PE=2 SV=1 10 82 1.0E-06
sp|P49311|GRP2_SINAL Glycine-rich RNA-binding protein GRP2A OS=Sinapis alba PE=2 SV=1 10 82 1.0E-06
sp|Q8L716|U2A2B_ARATH Splicing factor U2af large subunit B OS=Arabidopsis thaliana GN=U2AF65B PE=2 SV=2 6 81 1.0E-06
sp|Q5XFR0|EPAB2_MOUSE Embryonic polyadenylate-binding protein 2 OS=Mus musculus GN=Pabpn1l PE=2 SV=1 8 81 1.0E-06
sp|Q5ZKR5|NCBP2_CHICK Nuclear cap-binding protein subunit 2 OS=Gallus gallus GN=NCBP2 PE=2 SV=1 7 90 1.0E-06
sp|Q6TY21|EPA2B_XENLA Embryonic polyadenylate-binding protein 2-B OS=Xenopus laevis GN=Pabpn1l-b PE=1 SV=1 8 81 2.0E-06
sp|Q9FMP4|SF3B6_ARATH Splicing factor 3B subunit 6-like protein OS=Arabidopsis thaliana GN=At5g12190 PE=2 SV=1 5 81 2.0E-06
sp|P49310|GRP1_SINAL Glycine-rich RNA-binding protein GRP1A OS=Sinapis alba PE=2 SV=1 10 82 2.0E-06
sp|B7P877|NCBP2_IXOSC Nuclear cap-binding protein subunit 2 OS=Ixodes scapularis GN=Cbp20 PE=3 SV=1 7 83 2.0E-06
sp|P19018|TRA2_DROME Transformer-2 sex-determining protein OS=Drosophila melanogaster GN=tra2 PE=1 SV=1 7 84 2.0E-06
sp|Q9BYG3|MK67I_HUMAN MKI67 FHA domain-interacting nucleolar phosphoprotein OS=Homo sapiens GN=NIFK PE=1 SV=1 9 83 2.0E-06
sp|Q9V3G3|PPIE_DROME Peptidyl-prolyl cis-trans isomerase E OS=Drosophila melanogaster GN=cyp33 PE=1 SV=1 7 84 2.0E-06
sp|Q804A5|EPA2A_XENLA Embryonic polyadenylate-binding protein 2-A OS=Xenopus laevis GN=Pabpn1l-a PE=1 SV=1 7 81 2.0E-06
sp|Q6PFR5|TRA2A_MOUSE Transformer-2 protein homolog alpha OS=Mus musculus GN=Tra2a PE=1 SV=1 17 84 2.0E-06
sp|Q13595|TRA2A_HUMAN Transformer-2 protein homolog alpha OS=Homo sapiens GN=TRA2A PE=1 SV=1 17 84 3.0E-06
sp|Q8CCS6|PABP2_MOUSE Polyadenylate-binding protein 2 OS=Mus musculus GN=Pabpn1 PE=1 SV=3 7 81 3.0E-06
sp|O93235|CIRBA_XENLA Cold-inducible RNA-binding protein A OS=Xenopus laevis GN=cirbp-a PE=1 SV=2 10 82 3.0E-06
sp|Q28165|PABP2_BOVIN Polyadenylate-binding protein 2 OS=Bos taurus GN=PABPN1 PE=1 SV=3 7 81 3.0E-06
sp|Q86U42|PABP2_HUMAN Polyadenylate-binding protein 2 OS=Homo sapiens GN=PABPN1 PE=1 SV=3 7 81 3.0E-06
sp|Q9P383|NCBP2_SCHPO Nuclear cap-binding protein subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cbc2 PE=3 SV=1 7 90 3.0E-06
sp|P39697|RT19_ARATH 40S ribosomal protein S19, mitochondrial OS=Arabidopsis thaliana GN=RPS19 PE=1 SV=2 2 82 3.0E-06
sp|B4NB54|NCBP2_DROWI Nuclear cap-binding protein subunit 2 OS=Drosophila willistoni GN=Cbp20 PE=3 SV=1 5 83 3.0E-06
sp|Q9SYG4|UBP1A_ARATH Oligouridylate-binding protein 1A OS=Arabidopsis thaliana GN=UBP1A PE=1 SV=1 10 95 3.0E-06
sp|Q03251|RBG8_ARATH Glycine-rich RNA-binding protein 8 OS=Arabidopsis thaliana GN=RBG8 PE=1 SV=1 10 82 3.0E-06
sp|Q2H0U6|EIF3G_CHAGB Eukaryotic translation initiation factor 3 subunit G OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=TIF35 PE=3 SV=1 12 86 3.0E-06
sp|P19684|ROC5_NICSY 33 kDa ribonucleoprotein, chloroplastic OS=Nicotiana sylvestris PE=1 SV=1 10 82 4.0E-06
sp|Q05AT9|U1SBP_XENLA U11/U12 small nuclear ribonucleoprotein 35 kDa protein OS=Xenopus laevis GN=snrnp35 PE=2 SV=1 6 86 4.0E-06
sp|P62997|TRA2B_RAT Transformer-2 protein homolog beta OS=Rattus norvegicus GN=Tra2b PE=1 SV=1 17 84 4.0E-06
sp|P62996|TRA2B_MOUSE Transformer-2 protein homolog beta OS=Mus musculus GN=Tra2b PE=1 SV=1 17 84 4.0E-06
sp|P62995|TRA2B_HUMAN Transformer-2 protein homolog beta OS=Homo sapiens GN=TRA2B PE=1 SV=1 17 84 4.0E-06
sp|Q3ZBT6|TRA2B_BOVIN Transformer-2 protein homolog beta OS=Bos taurus GN=TRA2B PE=2 SV=1 17 84 4.0E-06
sp|P90978|U2AF2_CAEEL Splicing factor U2AF 65 kDa subunit OS=Caenorhabditis elegans GN=uaf-1 PE=2 SV=2 10 110 5.0E-06
sp|B4M205|NCB2A_DROVI Nuclear cap-binding protein subunit 2-A OS=Drosophila virilis GN=Cbp20-A PE=3 SV=1 7 83 6.0E-06
sp|O22173|PABP4_ARATH Polyadenylate-binding protein 4 OS=Arabidopsis thaliana GN=PAB4 PE=1 SV=1 10 83 6.0E-06
sp|Q5U259|ELV1B_XENLA ELAV-like protein 1-B OS=Xenopus laevis GN=elavl1-b PE=1 SV=1 10 84 6.0E-06
sp|Q42404|RU17_ARATH U1 small nuclear ribonucleoprotein 70 kDa OS=Arabidopsis thaliana GN=RNU1 PE=1 SV=1 6 82 7.0E-06
sp|Q6NQ72|THO4D_ARATH THO complex subunit 4D OS=Arabidopsis thaliana GN=ALY4 PE=1 SV=1 10 83 7.0E-06
sp|Q08BH5|RBM46_DANRE Probable RNA-binding protein 46 OS=Danio rerio GN=rbm46 PE=2 SV=1 8 74 8.0E-06
sp|Q7KNF2|PABP2_DROME Polyadenylate-binding protein 2 OS=Drosophila melanogaster GN=Pabp2 PE=1 SV=1 7 81 9.0E-06
sp|P20397|NUCL_XENLA Nucleolin OS=Xenopus laevis GN=ncl PE=2 SV=3 7 87 9.0E-06
sp|Q28ZX3|PABP2_DROPS Polyadenylate-binding protein 2 OS=Drosophila pseudoobscura pseudoobscura GN=Pabp2 PE=3 SV=1 7 81 9.0E-06
sp|O14327|PAB2_SCHPO Polyadenylate-binding protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pab2 PE=1 SV=1 10 58 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0031124 mRNA 3'-end processing Yes
GO:0003723 RNA binding Yes
GO:0090304 nucleic acid metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0006396 RNA processing No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0006397 mRNA processing No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0071704 organic substance metabolic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0044238 primary metabolic process No
GO:0003676 nucleic acid binding No
GO:0046483 heterocycle metabolic process No
GO:0016071 mRNA metabolic process No
GO:0016070 RNA metabolic process No
GO:0031123 RNA 3'-end processing No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2937
MSSRPPSRVVFVGNIPYGLSEEQITDIFSSAGKVERFRLVYDSETGRPKGFGFADYPDTDSASSAVRNLNDFEIM
GRKLRVDFSNEHKSGDDDNNQLSSIQNAHAANGAGAMHSYASQPTSLPPLPVGKDMPPGLTCTDAISRTLNTLPP
SQLLDILHQMKALASSDSQRATELLQQAPQLAYAVFQALLLMGLVSPEAIQSVAEPGAVLTQPSAAAFPTQIAGY
SAAGAAGSTNTPPAAAVPYAPPASAPQSYVAQAAAVQDSDALIRQVMELPQAQIDLLPEAEKQQILALRATFAAQ
RR*
Coding >OphauB2|2937
ATGTCTTCTCGACCTCCCTCGCGCGTCGTCTTTGTCGGCAATATACCCTATGGCCTTTCCGAAGAACAAATCACG
GATATATTCTCAAGTGCTGGCAAGGTAGAGCGCTTTCGCCTCGTGTACGACTCAGAGACTGGTCGTCCAAAGGGC
TTTGGATTTGCAGACTATCCTGACACCGACTCGGCCTCATCAGCTGTACGCAACCTCAATGATTTCGAAATCATG
GGCCGCAAATTACGCGTCGACTTCTCCAACGAGCACAAGAGTGGCGATGACGACAACAATCAGTTGTCGTCAATA
CAGAATGCCCACGCGGCAAACGGCGCTGGTGCAATGCACAGCTATGCCTCCCAGCCCACTTCTCTACCTCCTCTG
CCAGTTGGCAAGGATATGCCTCCTGGCTTGACCTGCACCGACGCCATCTCCCGCACCCTCAATACCCTTCCCCCC
TCGCAACTGCTCGACATACTGCACCAAATGAAAGCGCTTGCGTCGTCAGATTCCCAAAGAGCAACCGAGCTCCTG
CAACAAGCCCCGCAGCTCGCATACGCCGTCTTCCAGGCCCTTTTGCTCATGGGTCTCGTATCGCCAGAGGCAATC
CAGTCGGTTGCTGAACCTGGAGCTGTTCTTACCCAGCCATCGGCAGCTGCATTTCCAACACAGATTGCTGGTTAC
TCGGCTGCTGGGGCAGCTGGTAGCACCAATACGCCCCCGGCTGCCGCTGTGCCTTATGCGCCACCTGCATCGGCA
CCGCAATCCTACGTCGCCCAAGCTGCCGCGGTACAAGATTCCGATGCTCTGATAAGACAGGTCATGGAGCTGCCC
CAGGCCCAAATCGACTTGCTGCCTGAAGCTGAAAAGCAACAGATTCTGGCCTTGCGTGCTACATTTGCGGCTCAA
AGAAGATGA
Transcript >OphauB2|2937
ATGTCTTCTCGACCTCCCTCGCGCGTCGTCTTTGTCGGCAATATACCCTATGGCCTTTCCGAAGAACAAATCACG
GATATATTCTCAAGTGCTGGCAAGGTAGAGCGCTTTCGCCTCGTGTACGACTCAGAGACTGGTCGTCCAAAGGGC
TTTGGATTTGCAGACTATCCTGACACCGACTCGGCCTCATCAGCTGTACGCAACCTCAATGATTTCGAAATCATG
GGCCGCAAATTACGCGTCGACTTCTCCAACGAGCACAAGAGTGGCGATGACGACAACAATCAGTTGTCGTCAATA
CAGAATGCCCACGCGGCAAACGGCGCTGGTGCAATGCACAGCTATGCCTCCCAGCCCACTTCTCTACCTCCTCTG
CCAGTTGGCAAGGATATGCCTCCTGGCTTGACCTGCACCGACGCCATCTCCCGCACCCTCAATACCCTTCCCCCC
TCGCAACTGCTCGACATACTGCACCAAATGAAAGCGCTTGCGTCGTCAGATTCCCAAAGAGCAACCGAGCTCCTG
CAACAAGCCCCGCAGCTCGCATACGCCGTCTTCCAGGCCCTTTTGCTCATGGGTCTCGTATCGCCAGAGGCAATC
CAGTCGGTTGCTGAACCTGGAGCTGTTCTTACCCAGCCATCGGCAGCTGCATTTCCAACACAGATTGCTGGTTAC
TCGGCTGCTGGGGCAGCTGGTAGCACCAATACGCCCCCGGCTGCCGCTGTGCCTTATGCGCCACCTGCATCGGCA
CCGCAATCCTACGTCGCCCAAGCTGCCGCGGTACAAGATTCCGATGCTCTGATAAGACAGGTCATGGAGCTGCCC
CAGGCCCAAATCGACTTGCTGCCTGAAGCTGAAAAGCAACAGATTCTGGCCTTGCGTGCTACATTTGCGGCTCAA
AGAAGATGA
Gene >OphauB2|2937
ATGTCTTCTCGACCTCCCTCGCGCGTCGTCTTTGTCGGCAATATACCCTATGGTACGCCCGTCACCTTGCTTCTT
CGCGATGCTGCCCTTTTGCCCGCGATTCTGTCAACTCACGCTTTGATATTGGCACAGGCCTTTCCGAAGAACAAA
TCACGGATATATTCTCAAGTGCTGGCAAGGTAGAGCGCTTTCGCCTCGTGTACGACTCAGAGACTGGTCGTCCAA
AGGGCTTTGGATTTGCAGACTATCCTGACACCGGTAATGGACAGCCTTGCCTGCCCTCAAGTAGTCACGGCTGCT
GGCTAACTTGTACTTTGTTTGCAACTATAGACTCGGCCTCATCAGCTGTACGCAACCTCAATGATTTCGAAATCA
TGGGCCGCAAATTACGCGTCGACTTCTCCAACGAGCACAAGAGTGGCGATGACGACAACAATCAGGTTTGTCCGC
CTGATGGCTTGTAGGCTCAAGACGACTGACCAGTGACATGCAGTTGTCGTCAATACAGAATGCCCACGCGGCAAA
CGGCGCTGGTGCAATGCACAGCTATGCCTCCCAGCCCACTTCTCTACCTCCTCTGCCAGTTGGCAAGGATATGCC
TCCTGGCTTGACCTGCACCGACGCCATCTCCCGCACCCTCAATACCCTTCCCCCCTCGCAACTGCTCGACATACT
GCACCAAATGAAAGCGCTTGCGTCGTCAGATTCCCAAAGAGCAACCGAGCTCCTGCAACAAGCCCCGCAGCTCGC
ATACGCCGTCTTCCAGGCCCTTTTGCTCATGGGTCTCGTATCGCCAGAGGCAATCCAGTCGGTTGCTGAACCTGG
AGCTGTTCTTACCCAGCCATCGGCAGCTGCATTTCCAACACAGATTGCTGGTTACTCGGCTGCTGGGGCAGCTGG
TAGCACCAATACGCCCCCGGCTGCCGCTGTGCCTTATGCGCCACCTGCATCGGCACCGCAATCCTACGTCGCCCA
AGCTGCCGCGGTACAAGATTCCGATGCTCTGATAAGACAGGTCATGGAGCTGCCCCAGGCCCAAATCGACTTGCT
GCCTGAAGCTGAAAAGCAACAGATTCTGGCCTTGCGTGCTACATTTGCGGCTCAAAGAAGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail