Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2935
Gene name
LocationContig_2:103688..106014
Strand-
Gene length (bp)2326
Transcript length (bp)2157
Coding sequence length (bp)2157
Protein length (aa) 719

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08238 Sel1 Sel1 repeat 1.3E-02 543 573
PF08238 Sel1 Sel1 repeat 4.3E-02 607 635
PF08238 Sel1 Sel1 repeat 1.1E-01 642 675

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P87159|NIF1_SCHPO Mitosis inhibitor nif1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nif1 PE=1 SV=1 505 689 5.0E-18
sp|P38213|DSF2_YEAST Protein DSF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DSF2 PE=1 SV=2 512 689 6.0E-17

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 44 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2935
MVKRPGLLDLRADSSQSTTSSSSKVVRSPRLHVAGEAPPELSPLDAFALQSRLLAKQLQESTRDGNRISRLPPLT
AESPLVQQGRLGFFRSLSHDATAEQPQPQETVDVALKTEVQEAFAPEDRPRSMHPRMSRIPPTPEDTDSLPMPDM
PQPHAGDASRGRRLRLNSINSPGDYFGARKDRSPSPIHSAGHLDSDQISQSSPRRQQRGVYILNSPSKPKQVSYD
ELGLTPSMALHPGRSPSVVSSAPGDDDISSNPSASFHSLRPRKLSAASVALSQTIPSPATSAPFARSPPISRADT
PSLDQPTRQASSDSQPSFVLADESAHTPVSMHSETFMDHAEDGKNGAPSYIYSTFLLPRGKTLERPDHADGRHHW
DKSTTLPSPGQQSHTDAPPSPPTRPSSSATKNVPDDTVSLLSTATRPSMEQKKTSMDGSRLSPSGYASSGSNRPS
AESSRSEGSPRGRSTTASHHDNATRGRPPPSAGTSDSASTIRPPPTARSMAPSASEISAEEHLAKGIECHENGSL
NESTYHLRHAARQNHPTAMLLYALACRHGWGMRANQKEGVQWLRKAAEYASNEIAGDEDRAKEGKPSNFLESKTR
KAQFALSVYELGVSHMNGWGIEQDKALALRCFEIAGNWGDVDALAEAGFCYAQGLGCKKDLRKSAKFYRMAEAKG
MTMPGNSWIHKAKYQDDDDACSKEKHKRKGRSKSRTRTMFGRK*
Coding >OphauB2|2935
ATGGTGAAGCGGCCTGGCCTGCTGGACCTGCGGGCCGACTCGTCTCAATCGACCACGTCAAGCTCGTCCAAGGTG
GTGCGCTCTCCCCGTCTGCACGTGGCCGGCGAAGCGCCCCCCGAGCTGTCTCCCCTGGATGCCTTTGCCCTGCAG
AGTCGTCTTCTCGCCAAGCAACTGCAAGAAAGCACCAGGGATGGCAACAGAATCAGTCGCCTGCCTCCCCTGACG
GCTGAGAGCCCGTTGGTGCAGCAGGGGCGACTGGGCTTCTTCCGCTCTCTGTCACACGATGCCACGGCTGAGCAG
CCACAGCCACAGGAAACAGTCGATGTGGCCCTGAAAACCGAGGTTCAAGAGGCCTTTGCGCCCGAAGATCGGCCC
AGGTCAATGCATCCTCGAATGAGCCGCATCCCTCCCACGCCCGAAGACACAGATTCGTTGCCTATGCCTGACATG
CCGCAGCCCCATGCCGGAGACGCATCCAGAGGTCGTCGGCTTCGGCTGAATTCTATTAACTCGCCTGGCGACTAC
TTTGGAGCCCGCAAGGACCGCTCGCCCTCTCCAATACACAGCGCCGGCCACCTGGATTCGGACCAAATATCCCAG
TCTTCGCCTCGTCGCCAGCAGCGCGGCGTCTATATTTTGAATTCTCCGAGCAAGCCCAAGCAGGTTTCCTACGAT
GAGTTGGGCCTGACGCCGTCCATGGCTTTGCACCCGGGCCGCTCACCCAGCGTCGTGTCTTCTGCGCCGGGAGAT
GACGACATCTCCAGCAATCCCTCGGCTTCTTTTCATTCATTGCGTCCACGAAAGCTTTCGGCCGCCAGCGTGGCT
CTTTCCCAAACCATACCCTCGCCGGCCACCAGTGCCCCCTTTGCCAGATCCCCACCTATTAGCCGCGCCGACACG
CCTAGTCTTGACCAGCCTACGAGACAGGCCTCATCTGACAGCCAGCCGTCTTTTGTGTTGGCGGATGAATCGGCT
CACACACCAGTCAGTATGCACAGTGAGACCTTTATGGACCACGCCGAAGATGGCAAGAATGGCGCTCCTTCCTAT
ATCTACTCGACGTTTTTGTTGCCCCGAGGAAAGACTTTGGAACGGCCAGATCATGCTGATGGCAGGCATCACTGG
GATAAGTCGACGACGCTGCCCAGCCCTGGCCAGCAATCCCACACGGATGCGCCTCCGTCACCGCCAACGAGACCA
TCGAGCTCCGCGACAAAGAATGTCCCCGACGATACCGTGAGCCTGCTCAGCACGGCTACAAGGCCATCTATGGAG
CAAAAGAAGACAAGCATGGATGGTAGTCGTCTCAGTCCTTCTGGCTACGCCTCATCCGGCTCAAACCGTCCATCA
GCTGAATCGAGCCGCTCCGAGGGCTCTCCTCGAGGTCGATCGACCACAGCTTCGCATCATGATAATGCCACGCGT
GGCCGCCCACCTCCTTCGGCAGGCACCAGTGACTCTGCCAGCACAATCCGACCTCCCCCTACCGCGCGTTCAATG
GCACCCTCTGCCTCGGAAATATCGGCCGAAGAACACCTGGCCAAGGGCATTGAGTGCCATGAGAATGGTTCGCTG
AACGAGTCTACATATCACCTTCGACATGCTGCCCGGCAAAACCACCCCACGGCCATGCTTCTGTATGCTCTTGCC
TGCCGGCATGGATGGGGAATGCGGGCCAATCAAAAGGAAGGCGTTCAATGGCTGCGCAAGGCGGCGGAGTATGCG
AGTAATGAGATTGCAGGCGACGAGGATCGCGCCAAAGAGGGCAAGCCGTCTAATTTCCTCGAGAGTAAAACTCGC
AAGGCACAGTTTGCCCTGAGCGTTTACGAGCTGGGTGTCAGTCACATGAATGGATGGGGCATTGAGCAGGACAAG
GCTCTGGCCCTGCGCTGCTTTGAAATTGCTGGGAATTGGGGCGACGTTGATGCTCTTGCCGAAGCTGGCTTCTGC
TACGCGCAGGGTCTTGGATGCAAAAAAGATTTGCGAAAAAGCGCCAAGTTTTACCGCATGGCTGAAGCCAAAGGA
ATGACTATGCCTGGCAACAGCTGGATTCACAAGGCCAAGTATCAAGACGACGACGACGCTTGTTCCAAAGAAAAG
CACAAGAGAAAGGGACGAAGCAAATCTCGTACACGCACCATGTTCGGCCGCAAGTAA
Transcript >OphauB2|2935
ATGGTGAAGCGGCCTGGCCTGCTGGACCTGCGGGCCGACTCGTCTCAATCGACCACGTCAAGCTCGTCCAAGGTG
GTGCGCTCTCCCCGTCTGCACGTGGCCGGCGAAGCGCCCCCCGAGCTGTCTCCCCTGGATGCCTTTGCCCTGCAG
AGTCGTCTTCTCGCCAAGCAACTGCAAGAAAGCACCAGGGATGGCAACAGAATCAGTCGCCTGCCTCCCCTGACG
GCTGAGAGCCCGTTGGTGCAGCAGGGGCGACTGGGCTTCTTCCGCTCTCTGTCACACGATGCCACGGCTGAGCAG
CCACAGCCACAGGAAACAGTCGATGTGGCCCTGAAAACCGAGGTTCAAGAGGCCTTTGCGCCCGAAGATCGGCCC
AGGTCAATGCATCCTCGAATGAGCCGCATCCCTCCCACGCCCGAAGACACAGATTCGTTGCCTATGCCTGACATG
CCGCAGCCCCATGCCGGAGACGCATCCAGAGGTCGTCGGCTTCGGCTGAATTCTATTAACTCGCCTGGCGACTAC
TTTGGAGCCCGCAAGGACCGCTCGCCCTCTCCAATACACAGCGCCGGCCACCTGGATTCGGACCAAATATCCCAG
TCTTCGCCTCGTCGCCAGCAGCGCGGCGTCTATATTTTGAATTCTCCGAGCAAGCCCAAGCAGGTTTCCTACGAT
GAGTTGGGCCTGACGCCGTCCATGGCTTTGCACCCGGGCCGCTCACCCAGCGTCGTGTCTTCTGCGCCGGGAGAT
GACGACATCTCCAGCAATCCCTCGGCTTCTTTTCATTCATTGCGTCCACGAAAGCTTTCGGCCGCCAGCGTGGCT
CTTTCCCAAACCATACCCTCGCCGGCCACCAGTGCCCCCTTTGCCAGATCCCCACCTATTAGCCGCGCCGACACG
CCTAGTCTTGACCAGCCTACGAGACAGGCCTCATCTGACAGCCAGCCGTCTTTTGTGTTGGCGGATGAATCGGCT
CACACACCAGTCAGTATGCACAGTGAGACCTTTATGGACCACGCCGAAGATGGCAAGAATGGCGCTCCTTCCTAT
ATCTACTCGACGTTTTTGTTGCCCCGAGGAAAGACTTTGGAACGGCCAGATCATGCTGATGGCAGGCATCACTGG
GATAAGTCGACGACGCTGCCCAGCCCTGGCCAGCAATCCCACACGGATGCGCCTCCGTCACCGCCAACGAGACCA
TCGAGCTCCGCGACAAAGAATGTCCCCGACGATACCGTGAGCCTGCTCAGCACGGCTACAAGGCCATCTATGGAG
CAAAAGAAGACAAGCATGGATGGTAGTCGTCTCAGTCCTTCTGGCTACGCCTCATCCGGCTCAAACCGTCCATCA
GCTGAATCGAGCCGCTCCGAGGGCTCTCCTCGAGGTCGATCGACCACAGCTTCGCATCATGATAATGCCACGCGT
GGCCGCCCACCTCCTTCGGCAGGCACCAGTGACTCTGCCAGCACAATCCGACCTCCCCCTACCGCGCGTTCAATG
GCACCCTCTGCCTCGGAAATATCGGCCGAAGAACACCTGGCCAAGGGCATTGAGTGCCATGAGAATGGTTCGCTG
AACGAGTCTACATATCACCTTCGACATGCTGCCCGGCAAAACCACCCCACGGCCATGCTTCTGTATGCTCTTGCC
TGCCGGCATGGATGGGGAATGCGGGCCAATCAAAAGGAAGGCGTTCAATGGCTGCGCAAGGCGGCGGAGTATGCG
AGTAATGAGATTGCAGGCGACGAGGATCGCGCCAAAGAGGGCAAGCCGTCTAATTTCCTCGAGAGTAAAACTCGC
AAGGCACAGTTTGCCCTGAGCGTTTACGAGCTGGGTGTCAGTCACATGAATGGATGGGGCATTGAGCAGGACAAG
GCTCTGGCCCTGCGCTGCTTTGAAATTGCTGGGAATTGGGGCGACGTTGATGCTCTTGCCGAAGCTGGCTTCTGC
TACGCGCAGGGTCTTGGATGCAAAAAAGATTTGCGAAAAAGCGCCAAGTTTTACCGCATGGCTGAAGCCAAAGGA
ATGACTATGCCTGGCAACAGCTGGATTCACAAGGCCAAGTATCAAGACGACGACGACGCTTGTTCCAAAGAAAAG
CACAAGAGAAAGGGACGAAGCAAATCTCGTACACGCACCATGTTCGGCCGCAAGTAA
Gene >OphauB2|2935
ATGGTGAAGCGGCCTGGCCTGCTGGACCTGCGGGCCGACTCGTCTCAATCGACCACGTCAAGCTCGTCCAAGGTG
GTGCGCTCTCCCCGTCTGCACGTGGCCGGCGAAGCGCCCCCCGAGCTGTCTCCCCTGGATGCCTTTGCCCTGCAG
AGTCGTCTTCTCGCCAAGCAACTGCAAGAAAGCACCAGGGATGGCAACAGAATCAGTCGCCTGCCTCCCCTGACG
GCTGAGAGCCCGTTGGTGCAGCAGGGGCGACTGGGCTTCTTCCGCTCTCTGTCACACGATGCCACGGCTGAGCAG
CCACAGCCACAGGAAACAGTCGATGTGGCCCTGAAAACCGAGGTTCAAGAGGCCTTTGCGCCCGAAGATCGGCCC
AGGTCAATGCATCCTCGAATGAGCCGCATCCCTCCCACGCCCGAAGACACAGATTCGTTGCCTATGCCTGACATG
CCGCAGCCCCATGCCGGAGACGCATCCAGAGGTCGTCGGCTTCGGCTGAATTCTATTAACTCGCCTGGCGACTAC
TTTGGAGCCCGCAAGGACCGCTCGCCCTCTCCAATACACAGCGCCGGCCACCTGGATTCGGACCAAATATCCCAG
TCTTCGCCTCGTCGCCAGCAGCGCGGCGTCTATATTTTGAATTCTCCGAGCAAGCCCAAGCAGGTTTCCTACGAT
GAGTTGGGCCTGACGCCGTCCATGGCTTTGCACCCGGGCCGCTCACCCAGCGTCGTGTCTTCTGCGCCGGGAGAT
GACGACATCTCCAGCAATCCCTCGGCTTCTTTTCATTCATTGCGTCCACGAAAGCTTTCGGCCGCCAGCGTGGCT
CTTTCCCAAACCATACCCTCGCCGGCCACCAGTGCCCCCTTTGCCAGATCCCCGTCAGTTGCATCCGACTCGTCG
GCGCTTCCGCGCCCCTCGTTTAACTTCTCAAGACCTATTAGCCGCGCCGACACGCCTAGTCTTGACCAGCCTACG
AGACAGGCCTCATCTGACAGCCAGCCGTCTTTTGTGTTGGCGGATGAATCGGCTCACACACCAGTCAGTATGCAC
AGTGAGACCTTTATGGACCACGCCGAAGATGGCAAGAATGGCGCTCCTTCCTATATCTACTCGACGTTTTTGTTG
CCCCGAGGAAAGACTTTGGAACGGCCAGATCATGCTGATGGCAGGCATCACTGGGATAAGTCGACGACGCTGCCC
AGCCCTGGCCAGCAATCCCACACGGATGCGCCTCCGTCACCGCCAACGAGACCATCGAGCTCCGCGACAAAGAAT
GTCCCCGACGATACCGTGAGCCTGCTCAGCACGGCTACAAGGCCATCTATGGAGCAAAAGAAGACAAGCATGGAT
GGTAGTCGTCTCAGTCCTTCTGGCTACGCCTCATCCGGCTCAAACCGTCCATCAGCTGAATCGAGCCGCTCCGAG
GGCTCTCCTCGAGGTCGATCGACCACAGCTTCGCATCATGATAATGCCACGCGTGGCCGCCCACCTCCTTCGGCA
GGCACCAGTGACTCTGCCAGCACAATCCGACCTCCCCCTACCGCGCGTTCAATGGCACCCTCTGCCTCGGAAATA
TCGGCCGAAGAACACCTGGCCAAGGGCATTGAGTGCCATGAGAATGGTTCGCTGAACGAGTCTACATATCACCTT
CGACATGCTGCCCGGCAAAACCACCCCACGGCCATGCTTCTGTATGCTCTTGCCTGCCGGCATGGATGGGGAATG
CGGGCCAATCAAAAGGAAGGCGTTCAATGGCTGCGCAAGGCGGCGGAGTATGCGAGTAATGAGATTGCAGGCGAC
GAGGATCGCGCCAAAGAGGGCAAGCCGTCTAATTTCCTCGAGAGTAAAACTCGCAAGGCACAGTTTGCCCTGAGC
GTTTACGAGCTGGGTGTCAGTCACATGAATGGATGGGGCATTGAGCAGGACAAGGCTCTGGCCCTGCGCTGCTTT
GAAATTGCTGGGAGTGAGTAAATGACGCGACACTTAGTGCTTGGGTGTCAAGGCTGACGGTCGATGCAGATTGGG
GCGACGTTGATGCTCTTGCCGAAGCTGGCTTCTGCTACGCGCAGGGTCTTGGATGCAAAAAAGATTTGCGAAAAA
GCGCCAAGTTTTACCGCATGGCTGAAGCCAAAGGAATGACTATGCCTGGCAACAGCTGGTATGTCTTGACATTGA
CTGGCAGGACGGATGGGATACTAACACATGTATATCGTGTAGGATTCACAAGGCCAAGTATCAAGACGACGACGA
CGCTTGTTCCAAAGAAAAGCACAAGAGAAAGGGACGAAGCAAATCTCGTACACGCACCATGTTCGGCCGCAAGTA
A

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail