Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2935
Gene name
LocationContig_2:103688..106014
Strand-
Gene length (bp)2326
Transcript length (bp)2157
Coding sequence length (bp)2157
Protein length (aa) 719

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08238 Sel1 Sel1 repeat 1.3E-02 543 573
PF08238 Sel1 Sel1 repeat 4.3E-02 607 635
PF08238 Sel1 Sel1 repeat 1.1E-01 642 675

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P87159|NIF1_SCHPO Mitosis inhibitor nif1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nif1 PE=1 SV=1 505 689 5.0E-18
sp|P38213|DSF2_YEAST Protein DSF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DSF2 PE=1 SV=2 512 689 6.0E-17

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3936
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7972
Ophiocordyceps australis map64 (Brazil) OphauB2|2935 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|04422
Ophiocordyceps camponoti-rufipedis Ophun1|4381
Ophiocordyceps kimflemingae Ophio5|342
Ophiocordyceps subramaniannii Hirsu2|7837

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2935
MVKRPGLLDLRADSSQSTTSSSSKVVRSPRLHVAGEAPPELSPLDAFALQSRLLAKQLQESTRDGNRISRLPPLT
AESPLVQQGRLGFFRSLSHDATAEQPQPQETVDVALKTEVQEAFAPEDRPRSMHPRMSRIPPTPEDTDSLPMPDM
PQPHAGDASRGRRLRLNSINSPGDYFGARKDRSPSPIHSAGHLDSDQISQSSPRRQQRGVYILNSPSKPKQVSYD
ELGLTPSMALHPGRSPSVVSSAPGDDDISSNPSASFHSLRPRKLSAASVALSQTIPSPATSAPFARSPPISRADT
PSLDQPTRQASSDSQPSFVLADESAHTPVSMHSETFMDHAEDGKNGAPSYIYSTFLLPRGKTLERPDHADGRHHW
DKSTTLPSPGQQSHTDAPPSPPTRPSSSATKNVPDDTVSLLSTATRPSMEQKKTSMDGSRLSPSGYASSGSNRPS
AESSRSEGSPRGRSTTASHHDNATRGRPPPSAGTSDSASTIRPPPTARSMAPSASEISAEEHLAKGIECHENGSL
NESTYHLRHAARQNHPTAMLLYALACRHGWGMRANQKEGVQWLRKAAEYASNEIAGDEDRAKEGKPSNFLESKTR
KAQFALSVYELGVSHMNGWGIEQDKALALRCFEIAGNWGDVDALAEAGFCYAQGLGCKKDLRKSAKFYRMAEAKG
MTMPGNSWIHKAKYQDDDDACSKEKHKRKGRSKSRTRTMFGRK*
Coding >OphauB2|2935
ATGGTGAAGCGGCCTGGCCTGCTGGACCTGCGGGCCGACTCGTCTCAATCGACCACGTCAAGCTCGTCCAAGGTG
GTGCGCTCTCCCCGTCTGCACGTGGCCGGCGAAGCGCCCCCCGAGCTGTCTCCCCTGGATGCCTTTGCCCTGCAG
AGTCGTCTTCTCGCCAAGCAACTGCAAGAAAGCACCAGGGATGGCAACAGAATCAGTCGCCTGCCTCCCCTGACG
GCTGAGAGCCCGTTGGTGCAGCAGGGGCGACTGGGCTTCTTCCGCTCTCTGTCACACGATGCCACGGCTGAGCAG
CCACAGCCACAGGAAACAGTCGATGTGGCCCTGAAAACCGAGGTTCAAGAGGCCTTTGCGCCCGAAGATCGGCCC
AGGTCAATGCATCCTCGAATGAGCCGCATCCCTCCCACGCCCGAAGACACAGATTCGTTGCCTATGCCTGACATG
CCGCAGCCCCATGCCGGAGACGCATCCAGAGGTCGTCGGCTTCGGCTGAATTCTATTAACTCGCCTGGCGACTAC
TTTGGAGCCCGCAAGGACCGCTCGCCCTCTCCAATACACAGCGCCGGCCACCTGGATTCGGACCAAATATCCCAG
TCTTCGCCTCGTCGCCAGCAGCGCGGCGTCTATATTTTGAATTCTCCGAGCAAGCCCAAGCAGGTTTCCTACGAT
GAGTTGGGCCTGACGCCGTCCATGGCTTTGCACCCGGGCCGCTCACCCAGCGTCGTGTCTTCTGCGCCGGGAGAT
GACGACATCTCCAGCAATCCCTCGGCTTCTTTTCATTCATTGCGTCCACGAAAGCTTTCGGCCGCCAGCGTGGCT
CTTTCCCAAACCATACCCTCGCCGGCCACCAGTGCCCCCTTTGCCAGATCCCCACCTATTAGCCGCGCCGACACG
CCTAGTCTTGACCAGCCTACGAGACAGGCCTCATCTGACAGCCAGCCGTCTTTTGTGTTGGCGGATGAATCGGCT
CACACACCAGTCAGTATGCACAGTGAGACCTTTATGGACCACGCCGAAGATGGCAAGAATGGCGCTCCTTCCTAT
ATCTACTCGACGTTTTTGTTGCCCCGAGGAAAGACTTTGGAACGGCCAGATCATGCTGATGGCAGGCATCACTGG
GATAAGTCGACGACGCTGCCCAGCCCTGGCCAGCAATCCCACACGGATGCGCCTCCGTCACCGCCAACGAGACCA
TCGAGCTCCGCGACAAAGAATGTCCCCGACGATACCGTGAGCCTGCTCAGCACGGCTACAAGGCCATCTATGGAG
CAAAAGAAGACAAGCATGGATGGTAGTCGTCTCAGTCCTTCTGGCTACGCCTCATCCGGCTCAAACCGTCCATCA
GCTGAATCGAGCCGCTCCGAGGGCTCTCCTCGAGGTCGATCGACCACAGCTTCGCATCATGATAATGCCACGCGT
GGCCGCCCACCTCCTTCGGCAGGCACCAGTGACTCTGCCAGCACAATCCGACCTCCCCCTACCGCGCGTTCAATG
GCACCCTCTGCCTCGGAAATATCGGCCGAAGAACACCTGGCCAAGGGCATTGAGTGCCATGAGAATGGTTCGCTG
AACGAGTCTACATATCACCTTCGACATGCTGCCCGGCAAAACCACCCCACGGCCATGCTTCTGTATGCTCTTGCC
TGCCGGCATGGATGGGGAATGCGGGCCAATCAAAAGGAAGGCGTTCAATGGCTGCGCAAGGCGGCGGAGTATGCG
AGTAATGAGATTGCAGGCGACGAGGATCGCGCCAAAGAGGGCAAGCCGTCTAATTTCCTCGAGAGTAAAACTCGC
AAGGCACAGTTTGCCCTGAGCGTTTACGAGCTGGGTGTCAGTCACATGAATGGATGGGGCATTGAGCAGGACAAG
GCTCTGGCCCTGCGCTGCTTTGAAATTGCTGGGAATTGGGGCGACGTTGATGCTCTTGCCGAAGCTGGCTTCTGC
TACGCGCAGGGTCTTGGATGCAAAAAAGATTTGCGAAAAAGCGCCAAGTTTTACCGCATGGCTGAAGCCAAAGGA
ATGACTATGCCTGGCAACAGCTGGATTCACAAGGCCAAGTATCAAGACGACGACGACGCTTGTTCCAAAGAAAAG
CACAAGAGAAAGGGACGAAGCAAATCTCGTACACGCACCATGTTCGGCCGCAAGTAA
Transcript >OphauB2|2935
ATGGTGAAGCGGCCTGGCCTGCTGGACCTGCGGGCCGACTCGTCTCAATCGACCACGTCAAGCTCGTCCAAGGTG
GTGCGCTCTCCCCGTCTGCACGTGGCCGGCGAAGCGCCCCCCGAGCTGTCTCCCCTGGATGCCTTTGCCCTGCAG
AGTCGTCTTCTCGCCAAGCAACTGCAAGAAAGCACCAGGGATGGCAACAGAATCAGTCGCCTGCCTCCCCTGACG
GCTGAGAGCCCGTTGGTGCAGCAGGGGCGACTGGGCTTCTTCCGCTCTCTGTCACACGATGCCACGGCTGAGCAG
CCACAGCCACAGGAAACAGTCGATGTGGCCCTGAAAACCGAGGTTCAAGAGGCCTTTGCGCCCGAAGATCGGCCC
AGGTCAATGCATCCTCGAATGAGCCGCATCCCTCCCACGCCCGAAGACACAGATTCGTTGCCTATGCCTGACATG
CCGCAGCCCCATGCCGGAGACGCATCCAGAGGTCGTCGGCTTCGGCTGAATTCTATTAACTCGCCTGGCGACTAC
TTTGGAGCCCGCAAGGACCGCTCGCCCTCTCCAATACACAGCGCCGGCCACCTGGATTCGGACCAAATATCCCAG
TCTTCGCCTCGTCGCCAGCAGCGCGGCGTCTATATTTTGAATTCTCCGAGCAAGCCCAAGCAGGTTTCCTACGAT
GAGTTGGGCCTGACGCCGTCCATGGCTTTGCACCCGGGCCGCTCACCCAGCGTCGTGTCTTCTGCGCCGGGAGAT
GACGACATCTCCAGCAATCCCTCGGCTTCTTTTCATTCATTGCGTCCACGAAAGCTTTCGGCCGCCAGCGTGGCT
CTTTCCCAAACCATACCCTCGCCGGCCACCAGTGCCCCCTTTGCCAGATCCCCACCTATTAGCCGCGCCGACACG
CCTAGTCTTGACCAGCCTACGAGACAGGCCTCATCTGACAGCCAGCCGTCTTTTGTGTTGGCGGATGAATCGGCT
CACACACCAGTCAGTATGCACAGTGAGACCTTTATGGACCACGCCGAAGATGGCAAGAATGGCGCTCCTTCCTAT
ATCTACTCGACGTTTTTGTTGCCCCGAGGAAAGACTTTGGAACGGCCAGATCATGCTGATGGCAGGCATCACTGG
GATAAGTCGACGACGCTGCCCAGCCCTGGCCAGCAATCCCACACGGATGCGCCTCCGTCACCGCCAACGAGACCA
TCGAGCTCCGCGACAAAGAATGTCCCCGACGATACCGTGAGCCTGCTCAGCACGGCTACAAGGCCATCTATGGAG
CAAAAGAAGACAAGCATGGATGGTAGTCGTCTCAGTCCTTCTGGCTACGCCTCATCCGGCTCAAACCGTCCATCA
GCTGAATCGAGCCGCTCCGAGGGCTCTCCTCGAGGTCGATCGACCACAGCTTCGCATCATGATAATGCCACGCGT
GGCCGCCCACCTCCTTCGGCAGGCACCAGTGACTCTGCCAGCACAATCCGACCTCCCCCTACCGCGCGTTCAATG
GCACCCTCTGCCTCGGAAATATCGGCCGAAGAACACCTGGCCAAGGGCATTGAGTGCCATGAGAATGGTTCGCTG
AACGAGTCTACATATCACCTTCGACATGCTGCCCGGCAAAACCACCCCACGGCCATGCTTCTGTATGCTCTTGCC
TGCCGGCATGGATGGGGAATGCGGGCCAATCAAAAGGAAGGCGTTCAATGGCTGCGCAAGGCGGCGGAGTATGCG
AGTAATGAGATTGCAGGCGACGAGGATCGCGCCAAAGAGGGCAAGCCGTCTAATTTCCTCGAGAGTAAAACTCGC
AAGGCACAGTTTGCCCTGAGCGTTTACGAGCTGGGTGTCAGTCACATGAATGGATGGGGCATTGAGCAGGACAAG
GCTCTGGCCCTGCGCTGCTTTGAAATTGCTGGGAATTGGGGCGACGTTGATGCTCTTGCCGAAGCTGGCTTCTGC
TACGCGCAGGGTCTTGGATGCAAAAAAGATTTGCGAAAAAGCGCCAAGTTTTACCGCATGGCTGAAGCCAAAGGA
ATGACTATGCCTGGCAACAGCTGGATTCACAAGGCCAAGTATCAAGACGACGACGACGCTTGTTCCAAAGAAAAG
CACAAGAGAAAGGGACGAAGCAAATCTCGTACACGCACCATGTTCGGCCGCAAGTAA
Gene >OphauB2|2935
ATGGTGAAGCGGCCTGGCCTGCTGGACCTGCGGGCCGACTCGTCTCAATCGACCACGTCAAGCTCGTCCAAGGTG
GTGCGCTCTCCCCGTCTGCACGTGGCCGGCGAAGCGCCCCCCGAGCTGTCTCCCCTGGATGCCTTTGCCCTGCAG
AGTCGTCTTCTCGCCAAGCAACTGCAAGAAAGCACCAGGGATGGCAACAGAATCAGTCGCCTGCCTCCCCTGACG
GCTGAGAGCCCGTTGGTGCAGCAGGGGCGACTGGGCTTCTTCCGCTCTCTGTCACACGATGCCACGGCTGAGCAG
CCACAGCCACAGGAAACAGTCGATGTGGCCCTGAAAACCGAGGTTCAAGAGGCCTTTGCGCCCGAAGATCGGCCC
AGGTCAATGCATCCTCGAATGAGCCGCATCCCTCCCACGCCCGAAGACACAGATTCGTTGCCTATGCCTGACATG
CCGCAGCCCCATGCCGGAGACGCATCCAGAGGTCGTCGGCTTCGGCTGAATTCTATTAACTCGCCTGGCGACTAC
TTTGGAGCCCGCAAGGACCGCTCGCCCTCTCCAATACACAGCGCCGGCCACCTGGATTCGGACCAAATATCCCAG
TCTTCGCCTCGTCGCCAGCAGCGCGGCGTCTATATTTTGAATTCTCCGAGCAAGCCCAAGCAGGTTTCCTACGAT
GAGTTGGGCCTGACGCCGTCCATGGCTTTGCACCCGGGCCGCTCACCCAGCGTCGTGTCTTCTGCGCCGGGAGAT
GACGACATCTCCAGCAATCCCTCGGCTTCTTTTCATTCATTGCGTCCACGAAAGCTTTCGGCCGCCAGCGTGGCT
CTTTCCCAAACCATACCCTCGCCGGCCACCAGTGCCCCCTTTGCCAGATCCCCGTCAGTTGCATCCGACTCGTCG
GCGCTTCCGCGCCCCTCGTTTAACTTCTCAAGACCTATTAGCCGCGCCGACACGCCTAGTCTTGACCAGCCTACG
AGACAGGCCTCATCTGACAGCCAGCCGTCTTTTGTGTTGGCGGATGAATCGGCTCACACACCAGTCAGTATGCAC
AGTGAGACCTTTATGGACCACGCCGAAGATGGCAAGAATGGCGCTCCTTCCTATATCTACTCGACGTTTTTGTTG
CCCCGAGGAAAGACTTTGGAACGGCCAGATCATGCTGATGGCAGGCATCACTGGGATAAGTCGACGACGCTGCCC
AGCCCTGGCCAGCAATCCCACACGGATGCGCCTCCGTCACCGCCAACGAGACCATCGAGCTCCGCGACAAAGAAT
GTCCCCGACGATACCGTGAGCCTGCTCAGCACGGCTACAAGGCCATCTATGGAGCAAAAGAAGACAAGCATGGAT
GGTAGTCGTCTCAGTCCTTCTGGCTACGCCTCATCCGGCTCAAACCGTCCATCAGCTGAATCGAGCCGCTCCGAG
GGCTCTCCTCGAGGTCGATCGACCACAGCTTCGCATCATGATAATGCCACGCGTGGCCGCCCACCTCCTTCGGCA
GGCACCAGTGACTCTGCCAGCACAATCCGACCTCCCCCTACCGCGCGTTCAATGGCACCCTCTGCCTCGGAAATA
TCGGCCGAAGAACACCTGGCCAAGGGCATTGAGTGCCATGAGAATGGTTCGCTGAACGAGTCTACATATCACCTT
CGACATGCTGCCCGGCAAAACCACCCCACGGCCATGCTTCTGTATGCTCTTGCCTGCCGGCATGGATGGGGAATG
CGGGCCAATCAAAAGGAAGGCGTTCAATGGCTGCGCAAGGCGGCGGAGTATGCGAGTAATGAGATTGCAGGCGAC
GAGGATCGCGCCAAAGAGGGCAAGCCGTCTAATTTCCTCGAGAGTAAAACTCGCAAGGCACAGTTTGCCCTGAGC
GTTTACGAGCTGGGTGTCAGTCACATGAATGGATGGGGCATTGAGCAGGACAAGGCTCTGGCCCTGCGCTGCTTT
GAAATTGCTGGGAGTGAGTAAATGACGCGACACTTAGTGCTTGGGTGTCAAGGCTGACGGTCGATGCAGATTGGG
GCGACGTTGATGCTCTTGCCGAAGCTGGCTTCTGCTACGCGCAGGGTCTTGGATGCAAAAAAGATTTGCGAAAAA
GCGCCAAGTTTTACCGCATGGCTGAAGCCAAAGGAATGACTATGCCTGGCAACAGCTGGTATGTCTTGACATTGA
CTGGCAGGACGGATGGGATACTAACACATGTATATCGTGTAGGATTCACAAGGCCAAGTATCAAGACGACGACGA
CGCTTGTTCCAAAGAAAAGCACAAGAGAAAGGGACGAAGCAAATCTCGTACACGCACCATGTTCGGCCGCAAGTA
A

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail