Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2926
Gene name
LocationContig_2:80591..81651
Strand-
Gene length (bp)1060
Transcript length (bp)852
Coding sequence length (bp)852
Protein length (aa) 284

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02544 Steroid_dh 3-oxo-5-alpha-steroid 4-dehydrogenase 3.0E-11 201 267

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UT20|YFY8_SCHPO Uncharacterized protein C9.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC9.08c PE=3 SV=1 46 267 7.0E-28
sp|Q5K2N1|DET2_SOLLC Steroid 5-alpha-reductase DET2 OS=Solanum lycopersicum GN=DET2 PE=1 SV=1 28 282 6.0E-10
sp|Q68FF9|S5A1_MOUSE 3-oxo-5-alpha-steroid 4-dehydrogenase 1 OS=Mus musculus GN=Srd5a1 PE=2 SV=2 35 283 2.0E-09
sp|P24008|S5A1_RAT 3-oxo-5-alpha-steroid 4-dehydrogenase 1 OS=Rattus norvegicus GN=Srd5a1 PE=1 SV=2 54 267 9.0E-09
sp|A5PJS2|S5A1_BOVIN 3-oxo-5-alpha-steroid 4-dehydrogenase 1 OS=Bos taurus GN=SRD5A1 PE=2 SV=1 47 283 3.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UT20|YFY8_SCHPO Uncharacterized protein C9.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC9.08c PE=3 SV=1 46 267 7.0E-28
sp|Q5K2N1|DET2_SOLLC Steroid 5-alpha-reductase DET2 OS=Solanum lycopersicum GN=DET2 PE=1 SV=1 28 282 6.0E-10
sp|Q68FF9|S5A1_MOUSE 3-oxo-5-alpha-steroid 4-dehydrogenase 1 OS=Mus musculus GN=Srd5a1 PE=2 SV=2 35 283 2.0E-09
sp|P24008|S5A1_RAT 3-oxo-5-alpha-steroid 4-dehydrogenase 1 OS=Rattus norvegicus GN=Srd5a1 PE=1 SV=2 54 267 9.0E-09
sp|A5PJS2|S5A1_BOVIN 3-oxo-5-alpha-steroid 4-dehydrogenase 1 OS=Bos taurus GN=SRD5A1 PE=2 SV=1 47 283 3.0E-08
sp|Q99N99|S5A2_MOUSE 3-oxo-5-alpha-steroid 4-dehydrogenase 2 OS=Mus musculus GN=Srd5a2 PE=2 SV=1 55 267 1.0E-07
sp|Q38944|DET2_ARATH Steroid 5-alpha-reductase DET2 OS=Arabidopsis thaliana GN=DET2 PE=1 SV=2 93 280 3.0E-07
sp|O18765|S5A2_PIG 3-oxo-5-alpha-steroid 4-dehydrogenase 2 OS=Sus scrofa GN=SRD5A2 PE=2 SV=2 43 267 4.0E-07
sp|Q2QDF6|DET2_GOSHI Steroid 5-alpha-reductase DET2 OS=Gossypium hirsutum GN=DET2 PE=1 SV=1 112 280 1.0E-06
sp|P31214|S5A2_RAT 3-oxo-5-alpha-steroid 4-dehydrogenase 2 OS=Rattus norvegicus GN=Srd5a2 PE=1 SV=1 55 267 3.0E-06
sp|P31213|S5A2_HUMAN 3-oxo-5-alpha-steroid 4-dehydrogenase 2 OS=Homo sapiens GN=SRD5A2 PE=1 SV=1 32 267 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016627 oxidoreductase activity, acting on the CH-CH group of donors Yes
GO:0006629 lipid metabolic process Yes
GO:0003824 catalytic activity No
GO:0044238 primary metabolic process No
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0016491 oxidoreductase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.5

Transmembrane Domains

Domain # Start End Length
1 108 130 22
2 145 167 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2926
MSNKAIMEHWIPLTEEHYETLLCVWQFAYPLLGSLQWVLKWYGMGKTSTASRFNLPGRVAWATMEAPGFVTLLYT
MRHTAALRGVTDLPWQNRVLAGLFPSMAPIHPLVWCLALSFQLFNGLCLGSWLGGHGGGPVTQAQWSGQSSLWQF
ALGLAMFYAGLSSNFFHDEELREIRRRAQRKSGNKRESSDGANEGKSLCRQRHYEIPQAGLFRYMLYPHYLCEWI
EWAGFLVAAGWSCKPAWAFLVNEVCSMLPRAVRGKAWYIERFGVDGVGGKWTIVPGLV*
Coding >OphauB2|2926
ATGTCCAACAAGGCCATTATGGAGCACTGGATACCGCTCACTGAAGAGCACTATGAGACTCTACTCTGCGTATGG
CAATTTGCATACCCCCTGCTTGGCTCCCTGCAATGGGTATTGAAGTGGTATGGCATGGGCAAAACGTCGACAGCG
AGTCGGTTCAATTTGCCAGGGCGAGTGGCATGGGCAACCATGGAAGCTCCTGGGTTTGTCACGTTGCTGTATACC
ATGAGGCACACGGCAGCTTTGCGTGGGGTGACGGACCTTCCGTGGCAGAATAGAGTGCTGGCTGGGCTATTCCCG
TCCATGGCGCCTATCCACCCCCTGGTATGGTGTCTTGCGCTTAGCTTTCAGCTCTTCAACGGCCTCTGCTTGGGC
TCGTGGCTAGGCGGGCATGGCGGCGGTCCCGTGACGCAAGCACAATGGAGCGGACAGAGTTCTCTTTGGCAGTTT
GCTCTTGGTCTGGCCATGTTTTATGCCGGGCTCTCGAGCAACTTTTTCCACGACGAAGAGCTGAGGGAGATTCGG
CGGCGGGCGCAGCGCAAAAGTGGCAACAAGAGGGAAAGCAGTGATGGCGCAAATGAGGGAAAGAGTCTTTGCAGA
CAGAGACATTATGAGATTCCTCAGGCTGGCTTGTTCCGCTACATGCTGTATCCGCATTACCTGTGTGAGTGGATA
GAATGGGCGGGATTTCTTGTTGCGGCGGGATGGTCATGTAAGCCGGCTTGGGCGTTTCTGGTCAACGAGGTGTGC
TCGATGCTGCCGCGGGCCGTCAGGGGCAAGGCATGGTATATTGAGCGCTTTGGCGTGGATGGGGTTGGCGGCAAA
TGGACGATTGTGCCGGGCTTGGTTTGA
Transcript >OphauB2|2926
ATGTCCAACAAGGCCATTATGGAGCACTGGATACCGCTCACTGAAGAGCACTATGAGACTCTACTCTGCGTATGG
CAATTTGCATACCCCCTGCTTGGCTCCCTGCAATGGGTATTGAAGTGGTATGGCATGGGCAAAACGTCGACAGCG
AGTCGGTTCAATTTGCCAGGGCGAGTGGCATGGGCAACCATGGAAGCTCCTGGGTTTGTCACGTTGCTGTATACC
ATGAGGCACACGGCAGCTTTGCGTGGGGTGACGGACCTTCCGTGGCAGAATAGAGTGCTGGCTGGGCTATTCCCG
TCCATGGCGCCTATCCACCCCCTGGTATGGTGTCTTGCGCTTAGCTTTCAGCTCTTCAACGGCCTCTGCTTGGGC
TCGTGGCTAGGCGGGCATGGCGGCGGTCCCGTGACGCAAGCACAATGGAGCGGACAGAGTTCTCTTTGGCAGTTT
GCTCTTGGTCTGGCCATGTTTTATGCCGGGCTCTCGAGCAACTTTTTCCACGACGAAGAGCTGAGGGAGATTCGG
CGGCGGGCGCAGCGCAAAAGTGGCAACAAGAGGGAAAGCAGTGATGGCGCAAATGAGGGAAAGAGTCTTTGCAGA
CAGAGACATTATGAGATTCCTCAGGCTGGCTTGTTCCGCTACATGCTGTATCCGCATTACCTGTGTGAGTGGATA
GAATGGGCGGGATTTCTTGTTGCGGCGGGATGGTCATGTAAGCCGGCTTGGGCGTTTCTGGTCAACGAGGTGTGC
TCGATGCTGCCGCGGGCCGTCAGGGGCAAGGCATGGTATATTGAGCGCTTTGGCGTGGATGGGGTTGGCGGCAAA
TGGACGATTGTGCCGGGCTTGGTTTGA
Gene >OphauB2|2926
ATGTCCAACAAGGCCATTATGGAGCACTGGATACCGCTCACTGAAGAGCACTATGAGACTCTACTCTGCGTATGG
CAATTTGCATACCCCCTGGTATGTTGAGTGTAGCATTTGCAGCAGGTCTTTGCGCCTTGTCTAATGCTTGACAGC
TTGGCTCCCTGCAATGGGTATTGAAGTGGTATGGCATGGGCAAAACGTCGACAGCGAGTCGGTTCAATTTGCCAG
GGCGAGTGGCATGGGCAACCATGGAAGCTCCTGGGTTTGTCACGTTGCTGTATACCATGAGGCACACGGCAGCTT
TGCGTGGGGTGACGGACCTTCCGTGGCAGAATAGAGTGCTGGCTGGGCTATTCGTGAGTGGCATCTCGTATGGCC
GGTGGTCAGCATCAAGCTCCAGGAGCCTCTGGCGGCAATCAAACAAGGGACTGTGGGGTCGCATTGGCTGATGAA
TTGCAAACAGACAATCCACTACTCTTACAGAGCACTGCTTTTCCCCGTGCTGCAGCCGTCCATGGCGCCTATCCA
CCCCCTGGTATGGTGTCTTGCGCTTAGCTTTCAGCTCTTCAACGGCCTCTGCTTGGGCTCGTGGCTAGGCGGGCA
TGGCGGCGGTCCCGTGACGCAAGCACAATGGAGCGGACAGAGTTCTCTTTGGCAGTTTGCTCTTGGTCTGGCCAT
GTTTTATGCCGGGCTCTCGAGCAACTTTTTCCACGACGAAGAGCTGAGGGAGATTCGGCGGCGGGCGCAGCGCAA
AAGTGGCAACAAGAGGGAAAGCAGTGATGGCGCAAATGAGGGAAAGAGTCTTTGCAGACAGAGACATTATGAGAT
TCCTCAGGCTGGCTTGTTCCGCTACATGCTGTATCCGCATTACCTGTGTGAGTGGATAGAATGGGCGGGATTTCT
TGTTGCGGCGGGATGGTCATGTAAGCCGGCTTGGGCGTTTCTGGTCAACGAGGTGTGCTCGATGCTGCCGCGGGC
CGTCAGGGGCAAGGCATGGTATATTGAGCGCTTTGGCGTGGATGGGGTTGGCGGCAAATGGACGATTGTGCCGGG
CTTGGTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail