Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2925
Gene name
LocationContig_2:78548..80385
Strand+
Gene length (bp)1837
Transcript length (bp)1698
Coding sequence length (bp)1698
Protein length (aa) 566

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05577 Peptidase_S28 Serine carboxypeptidase S28 1.1E-30 61 435

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4AYS6|A1345_ARTBC Probable extracellular serine carboxypeptidase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01345 PE=1 SV=1 73 555 6.0E-29
sp|Q9QXE5|TSSP_MOUSE Thymus-specific serine protease OS=Mus musculus GN=Prss16 PE=2 SV=1 52 557 4.0E-21
sp|P34528|YM67_CAEEL Putative serine protease K12H4.7 OS=Caenorhabditis elegans GN=K12H4.7 PE=3 SV=2 1 528 2.0E-17
sp|Q9NQE7|TSSP_HUMAN Thymus-specific serine protease OS=Homo sapiens GN=PRSS16 PE=2 SV=2 57 528 3.0E-17
sp|Q1PF50|EDA2_ARATH Probable serine protease EDA2 OS=Arabidopsis thaliana GN=EDA2 PE=2 SV=2 59 285 3.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4AYS6|A1345_ARTBC Probable extracellular serine carboxypeptidase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01345 PE=1 SV=1 73 555 6.0E-29
sp|Q9QXE5|TSSP_MOUSE Thymus-specific serine protease OS=Mus musculus GN=Prss16 PE=2 SV=1 52 557 4.0E-21
sp|P34528|YM67_CAEEL Putative serine protease K12H4.7 OS=Caenorhabditis elegans GN=K12H4.7 PE=3 SV=2 1 528 2.0E-17
sp|Q9NQE7|TSSP_HUMAN Thymus-specific serine protease OS=Homo sapiens GN=PRSS16 PE=2 SV=2 57 528 3.0E-17
sp|Q1PF50|EDA2_ARATH Probable serine protease EDA2 OS=Arabidopsis thaliana GN=EDA2 PE=2 SV=2 59 285 3.0E-16
sp|P90893|YM9I_CAEEL Putative serine protease F56F10.1 OS=Caenorhabditis elegans GN=F56F10.1 PE=1 SV=2 36 528 1.0E-09
sp|P34676|PCP5_CAEEL Prolyl carboxy peptidase like protein 5 OS=Caenorhabditis elegans GN=pcp-5 PE=1 SV=1 44 210 6.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0008236 serine-type peptidase activity Yes
GO:0006508 proteolysis Yes
GO:0003824 catalytic activity No
GO:0044238 primary metabolic process No
GO:0017171 serine hydrolase activity No
GO:0006807 nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0008150 biological_process No
GO:0008233 peptidase activity No
GO:0008152 metabolic process No
GO:0071704 organic substance metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0019538 protein metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0043170 macromolecule metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2925
MLALLALLLLPCLPGALASYPNQPPRLRRPIPPGPRPLLSHGFRRDSSLGVAAVHEGSFEQLIDHANPSLGTFWQ
RYWWNADHYGGPTWPIVLNAPGESSIDGYQGYATNTTLPGAMAQAVGGAAIVLEHRYWGRSSPYANLTAATLQHL
TLQNAMRDVVRFAHLADLPFVRNASANATQSPSSPASTPWVLSGCSYPGALTAWLAALAPGTFAAYHTSSAVVQA
LSTMCEYFAPVERAMPSNCSSDFRRIIAHVDQVLAGPDDTQVARLKQQFGFADLRYNDDFAAALVNGLFDWQNTQ
FYTGYDPLHRMCDYIENMWPGSNATDPGARGVGLLKATAGFAKWSRDVMIPGSCVKTGYWSDKNTTACYDTHDAS
SPVFADTSVANTGNRQWMWLLCNEPFEYWQACGPGSEYQSGLVPKLLDRAYWRRQCALFFPDTDGMTYGLRKGRS
VDALNALTGGWGDSSITTAAMAAQGSPARGQPIIWTNGEFDPWRPATVSADRRPGGPLPSGDNAPVWIIPRGSHC
NDLLMRNGEANADVARIQRGEIDQVKRWVQDFYARRARGL*
Coding >OphauB2|2925
ATGCTCGCCCTGCTCGCCCTGCTGCTGCTGCCCTGTCTGCCTGGCGCCCTGGCCAGCTATCCCAACCAGCCTCCT
CGGCTGCGACGGCCAATCCCGCCCGGGCCAAGGCCGCTGCTGTCACATGGCTTCCGGCGCGACAGCAGCTTGGGC
GTGGCGGCGGTGCACGAGGGCTCCTTTGAGCAGCTCATCGACCACGCCAACCCCAGCCTGGGCACCTTTTGGCAG
CGCTACTGGTGGAACGCAGACCACTATGGCGGGCCGACGTGGCCCATTGTGCTCAACGCGCCCGGCGAGAGCTCC
ATTGACGGCTATCAGGGCTACGCCACCAACACCACCTTGCCCGGCGCCATGGCGCAGGCTGTGGGCGGCGCCGCC
ATTGTGCTGGAGCATCGCTACTGGGGCCGCAGCTCGCCATATGCCAACCTGACGGCCGCCACGCTGCAGCACCTG
ACGCTGCAAAACGCCATGCGCGACGTGGTGCGCTTTGCCCACCTGGCCGACCTGCCCTTTGTCCGCAACGCCTCG
GCCAACGCCACCCAGTCGCCCTCGTCGCCCGCCTCCACGCCCTGGGTCCTGTCGGGATGCTCCTATCCGGGCGCC
CTGACCGCCTGGCTTGCTGCCCTGGCCCCCGGCACCTTTGCCGCCTACCACACCTCGAGCGCCGTCGTCCAGGCC
CTCTCCACCATGTGCGAGTATTTTGCCCCGGTTGAGCGCGCCATGCCCTCCAACTGCAGCTCCGATTTCCGCCGC
ATCATTGCCCATGTCGACCAGGTCCTCGCCGGCCCCGACGACACCCAGGTTGCCCGCCTCAAGCAGCAGTTTGGC
TTTGCCGACCTCAGGTACAACGACGACTTTGCCGCCGCCCTCGTCAACGGCCTCTTTGACTGGCAAAACACCCAG
TTCTATACCGGCTACGACCCGCTGCACCGCATGTGCGACTACATCGAGAACATGTGGCCCGGCAGCAACGCCACA
GATCCCGGGGCCCGAGGCGTCGGCCTGCTCAAGGCCACCGCCGGCTTTGCAAAGTGGTCGCGAGACGTCATGATC
CCCGGCTCATGCGTCAAGACGGGATACTGGTCCGACAAAAACACCACCGCCTGCTACGACACACACGATGCCTCC
AGCCCCGTCTTTGCCGACACCTCCGTCGCCAACACGGGCAACCGCCAGTGGATGTGGCTTCTGTGCAACGAGCCC
TTTGAGTACTGGCAAGCCTGCGGCCCCGGCTCCGAGTACCAGTCGGGCCTGGTGCCCAAGCTGCTCGACCGCGCC
TACTGGCGTCGCCAATGCGCCCTCTTCTTCCCCGACACTGACGGCATGACGTACGGCCTGAGAAAGGGCCGCTCC
GTTGACGCGCTCAACGCCCTCACGGGCGGCTGGGGCGACTCCTCCATCACCACCGCCGCAATGGCAGCCCAGGGC
AGTCCCGCCAGGGGCCAGCCAATCATCTGGACAAACGGCGAGTTCGACCCCTGGCGCCCTGCCACCGTCTCGGCC
GACCGTCGCCCGGGCGGCCCGCTGCCCTCGGGAGACAATGCCCCCGTCTGGATCATCCCCCGCGGCTCTCACTGC
AACGACCTGCTGATGCGCAACGGCGAGGCCAATGCCGACGTTGCCCGCATCCAGAGGGGCGAGATAGACCAGGTC
AAGCGCTGGGTCCAAGACTTTTATGCCCGAAGAGCAAGGGGCCTGTAG
Transcript >OphauB2|2925
ATGCTCGCCCTGCTCGCCCTGCTGCTGCTGCCCTGTCTGCCTGGCGCCCTGGCCAGCTATCCCAACCAGCCTCCT
CGGCTGCGACGGCCAATCCCGCCCGGGCCAAGGCCGCTGCTGTCACATGGCTTCCGGCGCGACAGCAGCTTGGGC
GTGGCGGCGGTGCACGAGGGCTCCTTTGAGCAGCTCATCGACCACGCCAACCCCAGCCTGGGCACCTTTTGGCAG
CGCTACTGGTGGAACGCAGACCACTATGGCGGGCCGACGTGGCCCATTGTGCTCAACGCGCCCGGCGAGAGCTCC
ATTGACGGCTATCAGGGCTACGCCACCAACACCACCTTGCCCGGCGCCATGGCGCAGGCTGTGGGCGGCGCCGCC
ATTGTGCTGGAGCATCGCTACTGGGGCCGCAGCTCGCCATATGCCAACCTGACGGCCGCCACGCTGCAGCACCTG
ACGCTGCAAAACGCCATGCGCGACGTGGTGCGCTTTGCCCACCTGGCCGACCTGCCCTTTGTCCGCAACGCCTCG
GCCAACGCCACCCAGTCGCCCTCGTCGCCCGCCTCCACGCCCTGGGTCCTGTCGGGATGCTCCTATCCGGGCGCC
CTGACCGCCTGGCTTGCTGCCCTGGCCCCCGGCACCTTTGCCGCCTACCACACCTCGAGCGCCGTCGTCCAGGCC
CTCTCCACCATGTGCGAGTATTTTGCCCCGGTTGAGCGCGCCATGCCCTCCAACTGCAGCTCCGATTTCCGCCGC
ATCATTGCCCATGTCGACCAGGTCCTCGCCGGCCCCGACGACACCCAGGTTGCCCGCCTCAAGCAGCAGTTTGGC
TTTGCCGACCTCAGGTACAACGACGACTTTGCCGCCGCCCTCGTCAACGGCCTCTTTGACTGGCAAAACACCCAG
TTCTATACCGGCTACGACCCGCTGCACCGCATGTGCGACTACATCGAGAACATGTGGCCCGGCAGCAACGCCACA
GATCCCGGGGCCCGAGGCGTCGGCCTGCTCAAGGCCACCGCCGGCTTTGCAAAGTGGTCGCGAGACGTCATGATC
CCCGGCTCATGCGTCAAGACGGGATACTGGTCCGACAAAAACACCACCGCCTGCTACGACACACACGATGCCTCC
AGCCCCGTCTTTGCCGACACCTCCGTCGCCAACACGGGCAACCGCCAGTGGATGTGGCTTCTGTGCAACGAGCCC
TTTGAGTACTGGCAAGCCTGCGGCCCCGGCTCCGAGTACCAGTCGGGCCTGGTGCCCAAGCTGCTCGACCGCGCC
TACTGGCGTCGCCAATGCGCCCTCTTCTTCCCCGACACTGACGGCATGACGTACGGCCTGAGAAAGGGCCGCTCC
GTTGACGCGCTCAACGCCCTCACGGGCGGCTGGGGCGACTCCTCCATCACCACCGCCGCAATGGCAGCCCAGGGC
AGTCCCGCCAGGGGCCAGCCAATCATCTGGACAAACGGCGAGTTCGACCCCTGGCGCCCTGCCACCGTCTCGGCC
GACCGTCGCCCGGGCGGCCCGCTGCCCTCGGGAGACAATGCCCCCGTCTGGATCATCCCCCGCGGCTCTCACTGC
AACGACCTGCTGATGCGCAACGGCGAGGCCAATGCCGACGTTGCCCGCATCCAGAGGGGCGAGATAGACCAGGTC
AAGCGCTGGGTCCAAGACTTTTATGCCCGAAGAGCAAGGGGCCTGTAG
Gene >OphauB2|2925
ATGCTCGCCCTGCTCGCCCTGCTGCTGCTGCCCTGTCTGCCTGGCGCCCTGGCCAGCTATCCCAACCAGCCTCCT
CGGCTGCGACGGCCAATCCCGCCCGGGCCAAGGCCGCTGCTGTCACATGGCTTCCGGCGCGACAGCAGCTTGGGC
GTGGCGGCGGTGCACGAGGGCTCCTTTGAGCAGCTCATCGACCACGCCAACCCCAGCCTGGGCACCTTTTGGCAG
CGCTACTGGTGGAACGCAGACCACTATGGCGGGCCGACGTGGCCCATTGTGCTCAACGCGCCCGGCGAGAGCTCC
ATTGACGGCTATCAGGGCTACGCCACCAACACCACCTTGCCCGGCGCCATGGCGCAGGCTGTGGGCGGCGCCGCC
ATTGTGCTGGAGCATCGCTACTGGGGCCGCAGCTCGCCATATGCCAACCTGACGGCCGCCACGCTGCAGCACCTG
ACGCTGCAAAACGCCATGCGCGACGTGGTGCGCTTTGCCCACCTGGCCGACCTGCCCTTTGTCCGCAACGCCTCG
GCCAACGCCACCCAGTCGCCCTCGTCGCCCGCCTCCACGCCCTGGGTCCTGTCGGGATGCTCCTATCCGGGCGCC
CTGACCGCCTGGCTTGCTGCCCTGGCCCCCGGCACCTTTGCCGCCTACCACACCTCGAGCGCCGTCGTCCAGGCC
CTCTCCACCATGTGCGAGTATTTTGCCCCGGTTGAGCGCGCCATGCCCTCCAACTGCAGCTCCGATTTCCGCCGC
ATCATTGCCCATGTCGACCAGGTCCTCGCCGGCCCCGACGACACCCAGGTTGCCCGCCTCAAGCAGCAGTTTGGC
TTTGCCGACCTCAGGTACAACGACGACTTTGCCGCCGCCCTCGTCAACGGCCTCTTTGACTGGCAAAACACCCAG
TTCTATACCGGCTACGACCCGCTGCACCGCATGTGCGACTACATCGAGGTAGATGCTCTTTGCCTCGCCTCGAGC
CCAAGCCGCTGACTCAATCTCCGAAAAAGAACATGTGGCCCGGCAGCAACGCCACAGATCCCGGGGCCCGAGGCG
TCGGCCTGCTCAAGGCCACCGCCGGCTTTGCAAAGTGGTCGCGAGACGTCATGATCCCCGGCTGTAAGTCTCTGC
CTTGCCTTGGCCTGCCCTCTGCTTCCTTCTTCTTGCTTCCTCTTGCTTCCTCCCCTCTTACTCGCCAATAGCATG
CGTCAAGACGGGATACTGGTCCGACAAAAACACCACCGCCTGCTACGACACACACGATGCCTCCAGCCCCGTCTT
TGCCGACACCTCCGTCGCCAACACGGGCAACCGCCAGTGGATGTGGCTTCTGTGCAACGAGCCCTTTGAGTACTG
GCAAGCCTGCGGCCCCGGCTCCGAGTACCAGTCGGGCCTGGTGCCCAAGCTGCTCGACCGCGCCTACTGGCGTCG
CCAATGCGCCCTCTTCTTCCCCGACACTGACGGCATGACGTACGGCCTGAGAAAGGGCCGCTCCGTTGACGCGCT
CAACGCCCTCACGGGCGGCTGGGGCGACTCCTCCATCACCACCGCCGCAATGGCAGCCCAGGGCAGTCCCGCCAG
GGGCCAGCCAATCATCTGGACAAACGGCGAGTTCGACCCCTGGCGCCCTGCCACCGTCTCGGCCGACCGTCGCCC
GGGCGGCCCGCTGCCCTCGGGAGACAATGCCCCCGTCTGGATCATCCCCCGCGGCTCTCACTGCAACGACCTGCT
GATGCGCAACGGCGAGGCCAATGCCGACGTTGCCCGCATCCAGAGGGGCGAGATAGACCAGGTCAAGCGCTGGGT
CCAAGACTTTTATGCCCGAAGAGCAAGGGGCCTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail