Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2922
Gene name
LocationContig_2:69248..71253
Strand-
Gene length (bp)2005
Transcript length (bp)1827
Coding sequence length (bp)1827
Protein length (aa) 609

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01424 R3H R3H domain 2.4E-09 325 379
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 3.0E-05 181 251

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q09868|CIP2_SCHPO RNA-binding post-transcriptional regulator cip2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cip2 PE=1 SV=1 174 377 1.0E-50
sp|O42923|CIP1_SCHPO RNA-binding post-transcriptional regulator cip1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cip1 PE=1 SV=1 173 396 2.0E-39
sp|P34217|PIN4_YEAST RNA-binding protein PIN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PIN4 PE=1 SV=1 162 282 2.0E-39

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003676 nucleic acid binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0097159 organic cyclic compound binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3753
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2950
Ophiocordyceps australis map64 (Brazil) OphauB2|2922 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|03784
Ophiocordyceps camponoti-rufipedis Ophun1|589
Ophiocordyceps kimflemingae Ophio5|5000
Ophiocordyceps subramaniannii Hirsu2|7316

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2922
MSQQHHDMGYVDYAAANRSSSASRQTYGASPAFASGLSLPRQTQRPFDTPLGSSSLYPADRMGAFHPRAMDTMTA
AGGIPAGYMLDSGHTWSYPAPSVATVNGAVHGPNRQRSVNRRAALPPNWTDHTQLNMPNNLQPFHGSVNGIHLAN
GGLRVEQGPPHTSPDLRSTASDGDQLIPTAIVIKNIPFAVRKETLASIMLEMNLPQPYAFNYHFDNGVFRGLAFA
NFQSAEDTRVVIEAMNGMEVHGRKLRVEYKKMLPEAERERIEREKRERRGQLEEQHRAPILHQQSSFQSLGSMSQ
TQQRNPAGHLGDVDLNDPQTLEFYTELVMFKRDDAREILVFPPSIMPEHRRSIHILAHHMGLEHQSVGEADSRQL
TVLKRQQPSPTSNVANPAVANSLDMHKRGLSRAATFDFAADRESRAASSNYPHVVGRQGPTLELPGSPDGGGIPN
NLRAAKSFADLRSFTPSPSQASSSYLAPGMSGLGGGATARFGDYMGHAQSIHSANSGTPGPKNDGGLVAGMNSLS
LSPFDSSTSLSSQTRTPGAIGSQRPGVSGGSSKGAPERQPRGPEWETSGGFGRSRTNGHLQRESDSSDNASRTVP
TSASVRYH*
Coding >OphauB2|2922
ATGAGTCAACAGCACCATGATATGGGCTACGTCGACTACGCAGCCGCCAATCGCTCCTCGAGCGCTTCCAGGCAG
ACCTATGGTGCCTCTCCTGCATTTGCATCGGGCCTCTCCCTTCCCCGCCAGACGCAGCGGCCTTTTGACACCCCC
TTGGGCTCTTCATCTCTGTACCCTGCCGACCGAATGGGCGCCTTCCACCCCAGGGCCATGGACACCATGACGGCT
GCCGGGGGCATTCCCGCCGGCTACATGCTTGACAGTGGTCACACGTGGAGCTACCCTGCCCCCAGCGTGGCTACT
GTCAATGGTGCCGTTCATGGCCCTAACCGTCAAAGGAGCGTCAATCGGCGTGCCGCCCTACCTCCGAACTGGACC
GACCACACTCAGTTGAATATGCCCAACAATCTACAGCCTTTTCACGGCTCCGTGAATGGTATACACTTGGCAAAT
GGTGGCCTGCGTGTTGAACAGGGCCCGCCGCATACGTCGCCTGATTTACGTTCGACGGCCTCTGATGGTGACCAA
CTCATTCCAACGGCGATTGTAATCAAGAACATACCTTTTGCAGTGCGCAAGGAAACACTGGCTTCCATTATGCTC
GAGATGAACTTGCCCCAGCCTTACGCCTTCAACTACCATTTTGACAATGGCGTCTTTCGTGGGCTGGCTTTTGCA
AACTTTCAATCCGCCGAAGACACGAGGGTTGTAATTGAGGCCATGAATGGCATGGAAGTCCATGGCCGTAAATTG
CGTGTTGAATACAAGAAGATGCTGCCAGAGGCGGAGCGCGAAAGAATCGAGAGAGAGAAGCGGGAGCGTCGCGGC
CAGCTCGAGGAACAACATCGCGCTCCCATTTTACACCAACAGAGCTCTTTTCAATCTCTTGGAAGCATGTCCCAG
ACCCAACAGCGGAATCCTGCGGGACACCTAGGAGATGTAGACCTCAATGACCCCCAAACCCTCGAGTTCTACACT
GAACTAGTCATGTTCAAACGCGACGATGCGCGCGAGATTCTTGTGTTTCCTCCCTCGATAATGCCCGAGCATAGG
CGATCGATTCACATTCTTGCCCATCATATGGGACTTGAGCACCAGTCGGTTGGAGAAGCCGACTCGCGGCAGCTG
ACAGTACTCAAACGCCAGCAACCTTCGCCCACATCCAATGTCGCAAATCCTGCTGTAGCCAACAGCCTTGATATG
CACAAGCGCGGGCTCAGTCGTGCTGCAACCTTTGATTTTGCCGCCGATCGGGAGAGTCGGGCGGCGAGTAGCAAC
TACCCCCATGTCGTGGGTCGCCAAGGCCCTACTTTGGAGCTTCCTGGCAGCCCCGACGGTGGTGGCATTCCAAAC
AACCTGCGCGCAGCCAAGAGCTTTGCCGATCTGCGCTCATTTACCCCCAGCCCCTCGCAAGCATCGTCGAGTTAC
CTGGCACCGGGCATGAGTGGCTTGGGCGGCGGCGCAACAGCTCGGTTTGGAGACTACATGGGCCATGCGCAGTCG
ATTCATTCGGCAAACTCTGGAACTCCCGGTCCCAAGAATGACGGCGGCCTCGTGGCTGGCATGAATAGTCTCAGT
TTAAGCCCATTCGACTCAAGCACCTCACTGTCCTCGCAGACGCGGACTCCTGGCGCAATTGGAAGCCAGAGACCA
GGCGTTAGCGGTGGAAGCTCCAAGGGTGCCCCAGAAAGGCAGCCACGAGGTCCTGAATGGGAAACGTCTGGTGGC
TTTGGCCGAAGCAGGACAAATGGGCATTTACAACGCGAAAGTGATTCTTCCGACAATGCTTCCCGTACTGTGCCT
ACCTCTGCCAGCGTGCGATACCATTAG
Transcript >OphauB2|2922
ATGAGTCAACAGCACCATGATATGGGCTACGTCGACTACGCAGCCGCCAATCGCTCCTCGAGCGCTTCCAGGCAG
ACCTATGGTGCCTCTCCTGCATTTGCATCGGGCCTCTCCCTTCCCCGCCAGACGCAGCGGCCTTTTGACACCCCC
TTGGGCTCTTCATCTCTGTACCCTGCCGACCGAATGGGCGCCTTCCACCCCAGGGCCATGGACACCATGACGGCT
GCCGGGGGCATTCCCGCCGGCTACATGCTTGACAGTGGTCACACGTGGAGCTACCCTGCCCCCAGCGTGGCTACT
GTCAATGGTGCCGTTCATGGCCCTAACCGTCAAAGGAGCGTCAATCGGCGTGCCGCCCTACCTCCGAACTGGACC
GACCACACTCAGTTGAATATGCCCAACAATCTACAGCCTTTTCACGGCTCCGTGAATGGTATACACTTGGCAAAT
GGTGGCCTGCGTGTTGAACAGGGCCCGCCGCATACGTCGCCTGATTTACGTTCGACGGCCTCTGATGGTGACCAA
CTCATTCCAACGGCGATTGTAATCAAGAACATACCTTTTGCAGTGCGCAAGGAAACACTGGCTTCCATTATGCTC
GAGATGAACTTGCCCCAGCCTTACGCCTTCAACTACCATTTTGACAATGGCGTCTTTCGTGGGCTGGCTTTTGCA
AACTTTCAATCCGCCGAAGACACGAGGGTTGTAATTGAGGCCATGAATGGCATGGAAGTCCATGGCCGTAAATTG
CGTGTTGAATACAAGAAGATGCTGCCAGAGGCGGAGCGCGAAAGAATCGAGAGAGAGAAGCGGGAGCGTCGCGGC
CAGCTCGAGGAACAACATCGCGCTCCCATTTTACACCAACAGAGCTCTTTTCAATCTCTTGGAAGCATGTCCCAG
ACCCAACAGCGGAATCCTGCGGGACACCTAGGAGATGTAGACCTCAATGACCCCCAAACCCTCGAGTTCTACACT
GAACTAGTCATGTTCAAACGCGACGATGCGCGCGAGATTCTTGTGTTTCCTCCCTCGATAATGCCCGAGCATAGG
CGATCGATTCACATTCTTGCCCATCATATGGGACTTGAGCACCAGTCGGTTGGAGAAGCCGACTCGCGGCAGCTG
ACAGTACTCAAACGCCAGCAACCTTCGCCCACATCCAATGTCGCAAATCCTGCTGTAGCCAACAGCCTTGATATG
CACAAGCGCGGGCTCAGTCGTGCTGCAACCTTTGATTTTGCCGCCGATCGGGAGAGTCGGGCGGCGAGTAGCAAC
TACCCCCATGTCGTGGGTCGCCAAGGCCCTACTTTGGAGCTTCCTGGCAGCCCCGACGGTGGTGGCATTCCAAAC
AACCTGCGCGCAGCCAAGAGCTTTGCCGATCTGCGCTCATTTACCCCCAGCCCCTCGCAAGCATCGTCGAGTTAC
CTGGCACCGGGCATGAGTGGCTTGGGCGGCGGCGCAACAGCTCGGTTTGGAGACTACATGGGCCATGCGCAGTCG
ATTCATTCGGCAAACTCTGGAACTCCCGGTCCCAAGAATGACGGCGGCCTCGTGGCTGGCATGAATAGTCTCAGT
TTAAGCCCATTCGACTCAAGCACCTCACTGTCCTCGCAGACGCGGACTCCTGGCGCAATTGGAAGCCAGAGACCA
GGCGTTAGCGGTGGAAGCTCCAAGGGTGCCCCAGAAAGGCAGCCACGAGGTCCTGAATGGGAAACGTCTGGTGGC
TTTGGCCGAAGCAGGACAAATGGGCATTTACAACGCGAAAGTGATTCTTCCGACAATGCTTCCCGTACTGTGCCT
ACCTCTGCCAGCGTGCGATACCATTAG
Gene >OphauB2|2922
ATGAGTCAACAGCACCATGATATGGGCTACGTCGACTACGCAGCCGCCAATCGCTCCTCGAGCGCTTCCAGGCAG
ACCTATGGTGCCTCTCCTGCATTTGCATCGGGCCTCTCCCTTCCCCGCCAGACGCAGCGGCCTTTTGACACCCCC
TTGGGCTCTTCATCTCTGTACCCTGCCGACCGAATGGGCGCCTTCCACCCCAGGGCCATGGACACCATGACGGCT
GCCGGGGGCATTCCCGCCGGCTACATGCTTGACAGTGGTCACACGTGGAGCTACCCTGCCCCCAGCGTGGCTACT
GTCAATGGTGCCGTTCATGGCCCTAACCGTCAAAGGAGCGTCAATCGGCGTGCCGCCCTACCTCCGGTGTGTCCA
TGCAGGCCATTGTAGAAGTCTCAATTGTCCCACACGTGAGCTAATTCTAGCCATTTAGAACTGGACCGACCACAC
TCAGTTGAATATGCCCAACAATCTACAGCCTTTTCACGGCTCCGTGAATGGTATACACTTGGCAAATGGTGGCCT
GCGTGTTGAACAGGGCCCGCCGCATACGTCGCCTGATTTACGTTCGACGGCCTCTGATGGTGACCAACTCATTCC
AACGGCGATTGTAATCAAGAACATACCTTTTGCAGTGCGCAAGGAAACACTGGCTTCCATTATGCTCGAGATGAA
CTTGCCCCAGCCTTACGCCTTCAACTACCATTTTGACAATGGCGTCTTTCGTGGGCTGGCTTTTGCAAACTTTCA
ATCCGCCGAAGACACGAGGGTTGTAATTGAGGCCATGAATGGCATGGAAGTCCATGGCCGTAAATTGCGTGTTGA
ATACAAGAAGATGCTGCCAGAGGCGGAGCGCGAAAGAATCGAGAGAGAGAAGCGGGAGCGTCGCGGCCAGCTCGA
GGAACAACATCGCGCTCCCATTTTACACCAACAGAGCTCTTTTCAATCTCTTGGAAGCATGTCCCAGACCCAACA
GCGGAATCCTGCGGGACACCTAGGTTTGTTTTCTTTTTCTGCCTTGCCATCAGGTTTCCATCTTGGCTGACACGC
ATGCCCAGGAGATGTAGACCTCAATGACCCCCAAACCCTCGAGTTCTACACTGAACTAGTCATGTTCAAACGCGA
CGATGCGCGCGAGATTCTTGTGTTTCCTCCCTCGATAATGCCCGAGCATAGGCGATCGATTCACATTCTTGCCCA
TCATATGGGACTTGAGCACCAGTCGGTTGGAGAAGCCGACTCGCGGCAGCTGACAGTACTCAAACGCCAGCAACC
TTCGCCCACATCCAATGTCGCAAATCCTGCTGTAGCCAACAGCCTTGATATGCACAAGCGCGGGCTCAGTCGTGC
TGCAACCTTTGATTTTGCCGCCGATCGGGAGAGTCGGGCGGCGAGTAGCAACTACCCCCATGTCGTGGGTCGCCA
AGGCCCTACTTTGGAGCTTCCTGGCAGCCCCGACGGTGGTGGCATTCCAAACAACCTGCGCGCAGCCAAGAGCTT
TGCCGATCTGCGCTCATTTACCCCCAGCCCCTCGCAAGCATCGTCGAGTTACCTGGCACCGGGCATGAGTGGCTT
GGGCGGCGGCGCAACAGCTCGGTTTGGAGACTACATGGGCCATGCGCAGTCGATTCATTCGGCAAACTCTGGAAC
TCCCGGTCCCAAGAATGACGGCGGCCTCGTGGCTGGCATGAATAGTCTCAGTTTAAGCCCATTCGACTCAAGCAC
CTCACTGTCCTCGCAGACGCGGACTCCTGGCGCAATTGGAAGCCAGAGACCAGGCGTTAGCGGTGGAAGCTCCAA
GGGTGCCCCAGAAAGGCAGCCACGAGGTCCTGAATGGGAAACGTCTGGTGGCTTTGGCCGAAGCAGGACAAATGG
GCATTTACAACGCGAAAGTGGTGTGTTGAGCAACAATTTGAAGCTGGATCATGTGGGCTGACCAAGATTAGATTC
TTCCGACAATGCTTCCCGTACTGTGCCTACCTCTGCCAGCGTGCGATACCATTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail