Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|291
Gene name
LocationContig_100:65056..66805
Strand-
Gene length (bp)1749
Transcript length (bp)1749
Coding sequence length (bp)1749
Protein length (aa) 583

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF19036 Fuz_longin_1 First Longin domain of FUZ, MON1 and HPS1 4.8E-30 162 284
PF19037 Fuz_longin_2 Second Longin domain of FUZ, MON1 and HPS1 3.9E-28 324 439
PF19038 Fuz_longin_3 Third Longin domain of FUZ, MON1 and HPS1 1.0E-23 472 571

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q2HFQ4|MON1_CHAGB Vacuolar fusion protein MON1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=MON1 PE=3 SV=1 24 582 0.0E+00
sp|Q870Q4|MON1_NEUCR Vacuolar fusion protein mon1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=apg-13 PE=3 SV=1 28 582 0.0E+00
sp|A1CEH4|MON1_ASPCL Vacuolar fusion protein mon1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=mon1 PE=3 SV=1 6 582 0.0E+00
sp|Q2ULR1|MON1_ASPOR Vacuolar fusion protein mon1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=mon1 PE=3 SV=1 6 582 0.0E+00
sp|Q1E8Q5|MON1_COCIM Vacuolar fusion protein MON1 OS=Coccidioides immitis (strain RS) GN=MON1 PE=3 SV=2 23 582 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q2HFQ4|MON1_CHAGB Vacuolar fusion protein MON1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=MON1 PE=3 SV=1 24 582 0.0E+00
sp|Q870Q4|MON1_NEUCR Vacuolar fusion protein mon1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=apg-13 PE=3 SV=1 28 582 0.0E+00
sp|A1CEH4|MON1_ASPCL Vacuolar fusion protein mon1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=mon1 PE=3 SV=1 6 582 0.0E+00
sp|Q2ULR1|MON1_ASPOR Vacuolar fusion protein mon1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=mon1 PE=3 SV=1 6 582 0.0E+00
sp|Q1E8Q5|MON1_COCIM Vacuolar fusion protein MON1 OS=Coccidioides immitis (strain RS) GN=MON1 PE=3 SV=2 23 582 0.0E+00
sp|Q4WHL1|MON1_ASPFU Vacuolar fusion protein mon1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mon1 PE=3 SV=2 23 582 0.0E+00
sp|Q4I6S5|MON1_GIBZE Vacuolar fusion protein MON1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=MON1 PE=3 SV=2 12 582 0.0E+00
sp|Q5BBI7|MON1_EMENI Vacuolar fusion protein mon1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mon1 PE=3 SV=1 151 582 2.0E-167
sp|Q0U822|MON1_PHANO Vacuolar fusion protein MON1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=MON1 PE=3 SV=1 79 565 1.0E-164
sp|Q0CJY1|MON1_ASPTN Vacuolar fusion protein mon1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=mon1 PE=3 SV=1 6 494 4.0E-152
sp|Q6CCU8|MON1_YARLI Vacuolar fusion protein MON1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MON1 PE=3 SV=1 159 582 3.0E-110
sp|Q9YGN1|SAND_TAKRU Protein SAND OS=Takifugu rubripes GN=sand PE=3 SV=1 149 577 2.0E-74
sp|Q5ZIH2|MON1A_CHICK Vacuolar fusion protein MON1 homolog A OS=Gallus gallus GN=MON1A PE=2 SV=1 149 577 9.0E-74
sp|Q6PDG8|MON1A_MOUSE Vacuolar fusion protein MON1 homolog A OS=Mus musculus GN=Mon1a PE=1 SV=3 119 577 1.0E-70
sp|Q86VX9|MON1A_HUMAN Vacuolar fusion protein MON1 homolog A OS=Homo sapiens GN=MON1A PE=1 SV=2 149 577 1.0E-69
sp|Q95KG9|MON1A_MACFA Vacuolar fusion protein MON1 homolog A OS=Macaca fascicularis GN=MON1A PE=2 SV=2 149 577 3.0E-69
sp|Q17QV2|MON1A_BOVIN Vacuolar fusion protein MON1 homolog A OS=Bos taurus GN=MON1A PE=2 SV=1 157 577 3.0E-69
sp|P0CO83|MON1_CRYNB Vacuolar fusion protein MON1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=MON1 PE=3 SV=1 164 582 2.0E-67
sp|Q8BMQ8|MON1B_MOUSE Vacuolar fusion protein MON1 homolog B OS=Mus musculus GN=Mon1b PE=2 SV=1 157 576 2.0E-67
sp|P0CO82|MON1_CRYNJ Vacuolar fusion protein MON1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=MON1 PE=3 SV=1 164 582 2.0E-67
sp|Q7L1V2|MON1B_HUMAN Vacuolar fusion protein MON1 homolog B OS=Homo sapiens GN=MON1B PE=1 SV=1 150 576 5.0E-66
sp|Q4R4E4|MON1B_MACFA Vacuolar fusion protein MON1 homolog B OS=Macaca fascicularis GN=MON1B PE=2 SV=1 150 576 2.0E-65
sp|P53129|MON1_YEAST Vacuolar fusion protein MON1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MON1 PE=1 SV=2 162 582 1.0E-54
sp|Q6FU19|MON1_CANGA Vacuolar fusion protein MON1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MON1 PE=3 SV=1 162 582 2.0E-53
sp|Q75EA2|MON1_ASHGO Vacuolar fusion protein MON1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MON1 PE=3 SV=2 162 582 1.0E-52
sp|Q10150|MON1_SCHPO Vacuolar fusion protein mon1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mon1 PE=3 SV=1 153 582 1.0E-47
sp|Q5A723|MON1_CANAL Vacuolar fusion protein MON1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MON1 PE=3 SV=1 58 576 1.0E-34
sp|Q6CKL5|MON1_KLULA Vacuolar fusion protein MON1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MON1 PE=3 SV=1 160 582 1.0E-29
sp|Q4PA36|MON1_USTMA Vacuolar fusion protein MON1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=MON1 PE=3 SV=1 162 429 2.0E-28
[Show less]

GO

GO Term Description Terminal node
GO:0016192 vesicle-mediated transport Yes
GO:0051179 localization No
GO:0008150 biological_process No
GO:0051234 establishment of localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 15 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|291
MGPHSDSGANTRPRPKATRGRQLQAQATTALTPVEIQTLSFPDGSRGTFSTHNTGDAPSTPAGSGRASPSTSRPS
PARTDRADDDASVASFAPTMRPAGDIASLLVGDLNKKSPAWNALLSQSSSVPPFAKGAQGRLANLHKEFEPLPEN
DSSLALWKSKLKHYMILSSAGKPVWSRHGHVGLINSSIGVVHTIISFYEGARNPLHAFTAGDSTFVVSAQGPLYF
VAISKLGESEAQLRAQLEALYMQILSTLTLPTLKNIFVNRPSSDLGKPLEGTESLLSSLADSFTKGSPSALLGAL
ECLKLRKSERHAINNTFLKLRADKLLYGLIVAGGKLVSVIRPRRHSLHPSDLQLIFNMLFESDGIKGGGGQSWIP
ICLPAFNSSGYLYMYVSFFDSVSGPEPAASAVSHDGPVCEEIAMVLISADRESFYSLKQMRDDVAHQLAKTNSLA
MIQRAVQLGRPTMAQVSPGSQVSHFIYKSRANVQFCMASLEPLFVSLLPHRRLMTLYHELHTAVHNKQAHVKVLH
RASDEVAALAWVTPAFELYCIGGPNVSRTSITQGANKIVQWAKREEQRLFIIGGAVF*
Coding >OphauB2|291
ATGGGGCCACATTCCGACTCTGGCGCCAACACACGGCCTCGACCAAAGGCGACGCGTGGCAGACAGCTGCAGGCA
CAGGCTACGACGGCCCTTACTCCGGTCGAGATTCAGACGCTGTCTTTTCCCGATGGCTCCCGCGGGACCTTTTCC
ACACACAACACGGGCGATGCGCCCTCGACGCCTGCCGGCAGCGGCCGCGCATCTCCCTCCACCTCGAGGCCCAGT
CCGGCCAGGACGGACCGCGCCGATGATGATGCCAGTGTCGCCAGCTTTGCCCCCACGATGCGTCCGGCTGGCGAC
ATAGCCAGTCTTCTAGTCGGAGACTTGAACAAGAAGAGCCCGGCCTGGAATGCCCTCTTGTCCCAGTCATCGTCA
GTGCCGCCATTTGCCAAGGGCGCCCAGGGGCGGCTGGCCAATTTGCACAAAGAGTTTGAGCCTCTGCCTGAAAAC
GACTCGAGCCTGGCGCTCTGGAAGTCGAAGCTCAAGCACTACATGATTTTGTCGTCTGCAGGCAAGCCCGTCTGG
AGTCGTCACGGCCACGTCGGCCTCATCAACTCCTCCATTGGCGTCGTGCACACCATCATCTCGTTTTACGAGGGC
GCCCGCAATCCTCTACACGCCTTCACTGCCGGAGACTCGACCTTTGTTGTGTCGGCGCAGGGGCCCCTCTACTTT
GTTGCCATCAGCAAGCTGGGCGAGAGCGAAGCGCAGCTCAGGGCTCAGCTCGAGGCCCTCTACATGCAGATCCTC
TCCACTCTTACCCTTCCCACCCTCAAAAACATCTTTGTCAACCGGCCCTCGAGCGACCTGGGTAAGCCTCTCGAG
GGCACCGAATCCCTTCTCTCCTCCCTCGCCGACAGCTTCACCAAGGGCTCTCCTTCGGCTCTCTTGGGTGCCTTG
GAATGCCTCAAGCTCCGCAAGTCGGAACGCCATGCAATCAACAACACCTTTCTCAAGCTCCGCGCCGACAAGCTC
CTCTATGGACTCATTGTTGCTGGAGGCAAGCTCGTCAGTGTCATACGCCCTCGCCGCCACTCGCTGCACCCTAGT
GATCTGCAGCTCATCTTCAACATGCTTTTTGAATCCGACGGCATCAAGGGCGGAGGTGGCCAAAGTTGGATTCCC
ATCTGCCTGCCTGCATTCAACAGCTCGGGTTATCTCTACATGTACGTCAGCTTCTTTGACAGTGTCTCGGGCCCC
GAGCCTGCTGCATCTGCAGTCAGCCACGACGGTCCGGTATGCGAGGAAATCGCCATGGTGCTCATAAGCGCCGAC
CGAGAAAGCTTTTATAGCCTCAAGCAAATGAGAGATGATGTTGCTCATCAGTTGGCCAAGACGAATAGTCTTGCC
ATGATACAGAGGGCGGTCCAGCTAGGGCGGCCGACCATGGCCCAGGTTTCGCCAGGCAGCCAGGTCAGCCACTTC
ATCTACAAGTCGCGGGCCAATGTGCAGTTTTGCATGGCATCGCTCGAGCCCTTGTTTGTCTCTCTGCTCCCCCAC
CGGAGGCTCATGACTCTGTACCACGAGCTGCACACGGCGGTGCACAACAAGCAGGCTCATGTCAAGGTGCTGCAC
CGTGCCAGTGACGAGGTGGCGGCTTTGGCCTGGGTCACTCCAGCCTTTGAGCTCTACTGCATCGGGGGCCCAAAT
GTCTCGCGAACATCAATCACCCAAGGCGCAAACAAGATTGTGCAGTGGGCCAAAAGGGAAGAGCAACGCCTCTTC
ATCATCGGCGGCGCAGTTTTCTGA
Transcript >OphauB2|291
ATGGGGCCACATTCCGACTCTGGCGCCAACACACGGCCTCGACCAAAGGCGACGCGTGGCAGACAGCTGCAGGCA
CAGGCTACGACGGCCCTTACTCCGGTCGAGATTCAGACGCTGTCTTTTCCCGATGGCTCCCGCGGGACCTTTTCC
ACACACAACACGGGCGATGCGCCCTCGACGCCTGCCGGCAGCGGCCGCGCATCTCCCTCCACCTCGAGGCCCAGT
CCGGCCAGGACGGACCGCGCCGATGATGATGCCAGTGTCGCCAGCTTTGCCCCCACGATGCGTCCGGCTGGCGAC
ATAGCCAGTCTTCTAGTCGGAGACTTGAACAAGAAGAGCCCGGCCTGGAATGCCCTCTTGTCCCAGTCATCGTCA
GTGCCGCCATTTGCCAAGGGCGCCCAGGGGCGGCTGGCCAATTTGCACAAAGAGTTTGAGCCTCTGCCTGAAAAC
GACTCGAGCCTGGCGCTCTGGAAGTCGAAGCTCAAGCACTACATGATTTTGTCGTCTGCAGGCAAGCCCGTCTGG
AGTCGTCACGGCCACGTCGGCCTCATCAACTCCTCCATTGGCGTCGTGCACACCATCATCTCGTTTTACGAGGGC
GCCCGCAATCCTCTACACGCCTTCACTGCCGGAGACTCGACCTTTGTTGTGTCGGCGCAGGGGCCCCTCTACTTT
GTTGCCATCAGCAAGCTGGGCGAGAGCGAAGCGCAGCTCAGGGCTCAGCTCGAGGCCCTCTACATGCAGATCCTC
TCCACTCTTACCCTTCCCACCCTCAAAAACATCTTTGTCAACCGGCCCTCGAGCGACCTGGGTAAGCCTCTCGAG
GGCACCGAATCCCTTCTCTCCTCCCTCGCCGACAGCTTCACCAAGGGCTCTCCTTCGGCTCTCTTGGGTGCCTTG
GAATGCCTCAAGCTCCGCAAGTCGGAACGCCATGCAATCAACAACACCTTTCTCAAGCTCCGCGCCGACAAGCTC
CTCTATGGACTCATTGTTGCTGGAGGCAAGCTCGTCAGTGTCATACGCCCTCGCCGCCACTCGCTGCACCCTAGT
GATCTGCAGCTCATCTTCAACATGCTTTTTGAATCCGACGGCATCAAGGGCGGAGGTGGCCAAAGTTGGATTCCC
ATCTGCCTGCCTGCATTCAACAGCTCGGGTTATCTCTACATGTACGTCAGCTTCTTTGACAGTGTCTCGGGCCCC
GAGCCTGCTGCATCTGCAGTCAGCCACGACGGTCCGGTATGCGAGGAAATCGCCATGGTGCTCATAAGCGCCGAC
CGAGAAAGCTTTTATAGCCTCAAGCAAATGAGAGATGATGTTGCTCATCAGTTGGCCAAGACGAATAGTCTTGCC
ATGATACAGAGGGCGGTCCAGCTAGGGCGGCCGACCATGGCCCAGGTTTCGCCAGGCAGCCAGGTCAGCCACTTC
ATCTACAAGTCGCGGGCCAATGTGCAGTTTTGCATGGCATCGCTCGAGCCCTTGTTTGTCTCTCTGCTCCCCCAC
CGGAGGCTCATGACTCTGTACCACGAGCTGCACACGGCGGTGCACAACAAGCAGGCTCATGTCAAGGTGCTGCAC
CGTGCCAGTGACGAGGTGGCGGCTTTGGCCTGGGTCACTCCAGCCTTTGAGCTCTACTGCATCGGGGGCCCAAAT
GTCTCGCGAACATCAATCACCCAAGGCGCAAACAAGATTGTGCAGTGGGCCAAAAGGGAAGAGCAACGCCTCTTC
ATCATCGGCGGCGCAGTTTTCTGA
Gene >OphauB2|291
ATGGGGCCACATTCCGACTCTGGCGCCAACACACGGCCTCGACCAAAGGCGACGCGTGGCAGACAGCTGCAGGCA
CAGGCTACGACGGCCCTTACTCCGGTCGAGATTCAGACGCTGTCTTTTCCCGATGGCTCCCGCGGGACCTTTTCC
ACACACAACACGGGCGATGCGCCCTCGACGCCTGCCGGCAGCGGCCGCGCATCTCCCTCCACCTCGAGGCCCAGT
CCGGCCAGGACGGACCGCGCCGATGATGATGCCAGTGTCGCCAGCTTTGCCCCCACGATGCGTCCGGCTGGCGAC
ATAGCCAGTCTTCTAGTCGGAGACTTGAACAAGAAGAGCCCGGCCTGGAATGCCCTCTTGTCCCAGTCATCGTCA
GTGCCGCCATTTGCCAAGGGCGCCCAGGGGCGGCTGGCCAATTTGCACAAAGAGTTTGAGCCTCTGCCTGAAAAC
GACTCGAGCCTGGCGCTCTGGAAGTCGAAGCTCAAGCACTACATGATTTTGTCGTCTGCAGGCAAGCCCGTCTGG
AGTCGTCACGGCCACGTCGGCCTCATCAACTCCTCCATTGGCGTCGTGCACACCATCATCTCGTTTTACGAGGGC
GCCCGCAATCCTCTACACGCCTTCACTGCCGGAGACTCGACCTTTGTTGTGTCGGCGCAGGGGCCCCTCTACTTT
GTTGCCATCAGCAAGCTGGGCGAGAGCGAAGCGCAGCTCAGGGCTCAGCTCGAGGCCCTCTACATGCAGATCCTC
TCCACTCTTACCCTTCCCACCCTCAAAAACATCTTTGTCAACCGGCCCTCGAGCGACCTGGGTAAGCCTCTCGAG
GGCACCGAATCCCTTCTCTCCTCCCTCGCCGACAGCTTCACCAAGGGCTCTCCTTCGGCTCTCTTGGGTGCCTTG
GAATGCCTCAAGCTCCGCAAGTCGGAACGCCATGCAATCAACAACACCTTTCTCAAGCTCCGCGCCGACAAGCTC
CTCTATGGACTCATTGTTGCTGGAGGCAAGCTCGTCAGTGTCATACGCCCTCGCCGCCACTCGCTGCACCCTAGT
GATCTGCAGCTCATCTTCAACATGCTTTTTGAATCCGACGGCATCAAGGGCGGAGGTGGCCAAAGTTGGATTCCC
ATCTGCCTGCCTGCATTCAACAGCTCGGGTTATCTCTACATGTACGTCAGCTTCTTTGACAGTGTCTCGGGCCCC
GAGCCTGCTGCATCTGCAGTCAGCCACGACGGTCCGGTATGCGAGGAAATCGCCATGGTGCTCATAAGCGCCGAC
CGAGAAAGCTTTTATAGCCTCAAGCAAATGAGAGATGATGTTGCTCATCAGTTGGCCAAGACGAATAGTCTTGCC
ATGATACAGAGGGCGGTCCAGCTAGGGCGGCCGACCATGGCCCAGGTTTCGCCAGGCAGCCAGGTCAGCCACTTC
ATCTACAAGTCGCGGGCCAATGTGCAGTTTTGCATGGCATCGCTCGAGCCCTTGTTTGTCTCTCTGCTCCCCCAC
CGGAGGCTCATGACTCTGTACCACGAGCTGCACACGGCGGTGCACAACAAGCAGGCTCATGTCAAGGTGCTGCAC
CGTGCCAGTGACGAGGTGGCGGCTTTGGCCTGGGTCACTCCAGCCTTTGAGCTCTACTGCATCGGGGGCCCAAAT
GTCTCGCGAACATCAATCACCCAAGGCGCAAACAAGATTGTGCAGTGGGCCAAAAGGGAAGAGCAACGCCTCTTC
ATCATCGGCGGCGCAGTTTTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail