Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2909
Gene name
LocationContig_2:15959..18340
Strand+
Gene length (bp)2381
Transcript length (bp)2337
Coding sequence length (bp)2337
Protein length (aa) 779

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00566 RabGAP-TBC Rab-GTPase-TBC domain 2.0E-48 596 770

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09830|YAD4_SCHPO TBC domain-containing protein C4G8.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4G8.04 PE=1 SV=1 526 763 1.0E-73
sp|B1AVH7|TBD2A_MOUSE TBC1 domain family member 2A OS=Mus musculus GN=Tbc1d2 PE=2 SV=1 550 771 3.0E-45
sp|Q9BYX2|TBD2A_HUMAN TBC1 domain family member 2A OS=Homo sapiens GN=TBC1D2 PE=1 SV=3 550 770 3.0E-43
sp|B5DFA1|TBD2A_RAT TBC1 domain family member 2A OS=Rattus norvegicus GN=Tbc1d2 PE=2 SV=1 550 771 4.0E-43
sp|A6QP29|TBD2A_BOVIN TBC1 domain family member 2A OS=Bos taurus GN=TBC1D2 PE=2 SV=1 550 770 1.0E-41
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09830|YAD4_SCHPO TBC domain-containing protein C4G8.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4G8.04 PE=1 SV=1 526 763 1.0E-73
sp|B1AVH7|TBD2A_MOUSE TBC1 domain family member 2A OS=Mus musculus GN=Tbc1d2 PE=2 SV=1 550 771 3.0E-45
sp|Q9BYX2|TBD2A_HUMAN TBC1 domain family member 2A OS=Homo sapiens GN=TBC1D2 PE=1 SV=3 550 770 3.0E-43
sp|B5DFA1|TBD2A_RAT TBC1 domain family member 2A OS=Rattus norvegicus GN=Tbc1d2 PE=2 SV=1 550 771 4.0E-43
sp|A6QP29|TBD2A_BOVIN TBC1 domain family member 2A OS=Bos taurus GN=TBC1D2 PE=2 SV=1 550 770 1.0E-41
sp|Q28CB1|TBD2B_XENTR TBC1 domain family member 2B OS=Xenopus tropicalis GN=tbc1d2b PE=2 SV=1 551 771 5.0E-40
sp|A6H8I2|SGSM3_XENLA Small G protein signaling modulator 3 homolog OS=Xenopus laevis GN=sgsm3 PE=2 SV=1 551 777 8.0E-40
sp|D2H0G5|TBD2A_AILME TBC1 domain family member 2A OS=Ailuropoda melanoleuca GN=TBC1D2 PE=3 SV=1 551 745 1.0E-39
sp|Q3U0J8|TBD2B_MOUSE TBC1 domain family member 2B OS=Mus musculus GN=Tbc1d2b PE=1 SV=2 551 771 3.0E-39
sp|Q9UPU7|TBD2B_HUMAN TBC1 domain family member 2B OS=Homo sapiens GN=TBC1D2B PE=1 SV=2 551 771 4.0E-39
sp|Q8VCZ6|SGSM3_MOUSE Small G protein signaling modulator 3 OS=Mus musculus GN=Sgsm3 PE=1 SV=1 551 777 7.0E-39
sp|Q6P6R7|SGSM3_RAT Small G protein signaling modulator 3 OS=Rattus norvegicus GN=Sgsm3 PE=1 SV=1 551 777 8.0E-39
sp|Q96HU1|SGSM3_HUMAN Small G protein signaling modulator 3 OS=Homo sapiens GN=SGSM3 PE=1 SV=1 551 777 5.0E-38
sp|Q2KI13|SGSM3_BOVIN Small G protein signaling modulator 3 OS=Bos taurus GN=SGSM3 PE=2 SV=1 551 777 2.0E-37
sp|Q5TC63|GRTP1_HUMAN Growth hormone-regulated TBC protein 1 OS=Homo sapiens GN=GRTP1 PE=1 SV=4 553 771 5.0E-37
sp|Q9D3N8|GRTP1_MOUSE Growth hormone-regulated TBC protein 1 OS=Mus musculus GN=Grtp1 PE=1 SV=1 540 771 5.0E-37
sp|Q6PBU5|GRT1A_DANRE Growth hormone-regulated TBC protein 1-A OS=Danio rerio GN=grtp1a PE=2 SV=1 553 769 2.0E-35
sp|Q7T2D0|SGSM3_DANRE Small G protein signaling modulator 3 OS=Danio rerio GN=sgsm3 PE=2 SV=1 552 777 2.0E-35
sp|C8VDQ4|GYP2_EMENI Putative GTPase-activating protein AN11010 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN11010 PE=3 SV=1 552 770 4.0E-34
sp|Q66K14|TBC9B_HUMAN TBC1 domain family member 9B OS=Homo sapiens GN=TBC1D9B PE=1 SV=3 553 770 7.0E-34
sp|Q6GLZ0|GRTP1_XENLA Growth hormone-regulated TBC protein 1 OS=Xenopus laevis GN=grtp1 PE=2 SV=1 553 775 7.0E-34
sp|Q5SVR0|TBC9B_MOUSE TBC1 domain family member 9B OS=Mus musculus GN=Tbc1d9b PE=1 SV=1 553 770 1.0E-33
sp|P53258|GYP2_YEAST GTPase-activating protein GYP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDR1 PE=1 SV=1 552 773 3.0E-33
sp|Q6GL87|GRTP1_XENTR Growth hormone-regulated TBC protein 1 OS=Xenopus tropicalis GN=grtp1 PE=2 SV=1 553 775 9.0E-33
sp|Q9Z1A9|TBCD8_MOUSE TBC1 domain family member 8 OS=Mus musculus GN=Tbc1d8 PE=1 SV=2 513 769 2.0E-32
sp|Q6ZT07|TBCD9_HUMAN TBC1 domain family member 9 OS=Homo sapiens GN=TBC1D9 PE=2 SV=2 553 771 5.0E-32
sp|O95759|TBCD8_HUMAN TBC1 domain family member 8 OS=Homo sapiens GN=TBC1D8 PE=2 SV=3 515 769 8.0E-32
sp|Q4QQU7|GRTP1_RAT Growth hormone-regulated TBC protein 1 OS=Rattus norvegicus GN=Grtp1 PE=2 SV=1 606 771 3.0E-31
sp|Q3UYK3|TBCD9_MOUSE TBC1 domain family member 9 OS=Mus musculus GN=Tbc1d9 PE=2 SV=2 553 771 5.0E-31
sp|A3KGB4|TBC8B_MOUSE TBC1 domain family member 8B OS=Mus musculus GN=Tbc1d8b PE=1 SV=1 555 770 4.0E-30
sp|B0R0W9|TBC8B_DANRE TBC1 domain family member 8B OS=Danio rerio GN=tbc1d8b PE=3 SV=1 553 770 2.0E-29
sp|Q0IIM8|TBC8B_HUMAN TBC1 domain family member 8B OS=Homo sapiens GN=TBC1D8B PE=1 SV=2 555 770 1.0E-28
sp|O43048|YH51_SCHPO TBC domain-containing protein C215.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC215.01 PE=3 SV=4 550 771 1.0E-27
sp|O94711|GYP2_SCHPO GTPase-activating protein gyp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gyp2 PE=3 SV=1 552 771 3.0E-26
sp|Q9Y2I9|TBC30_HUMAN TBC1 domain family member 30 OS=Homo sapiens GN=TBC1D30 PE=1 SV=2 542 761 7.0E-26
sp|Q69ZT9|TBC30_MOUSE TBC1 domain family member 30 OS=Mus musculus GN=Tbc1d30 PE=1 SV=2 542 761 2.0E-25
sp|Q80XC3|US6NL_MOUSE USP6 N-terminal-like protein OS=Mus musculus GN=Usp6nl PE=1 SV=2 548 771 5.0E-25
sp|Q28C33|TBC30_XENTR TBC1 domain family member 30 OS=Xenopus tropicalis GN=tbc1d30 PE=2 SV=1 542 761 5.0E-25
sp|Q9BXI6|TB10A_HUMAN TBC1 domain family member 10A OS=Homo sapiens GN=TBC1D10A PE=1 SV=1 559 763 7.0E-25
sp|Q92738|US6NL_HUMAN USP6 N-terminal-like protein OS=Homo sapiens GN=USP6NL PE=1 SV=3 540 771 9.0E-25
sp|Q8IV04|TB10C_HUMAN Carabin OS=Homo sapiens GN=TBC1D10C PE=1 SV=1 548 772 1.0E-24
sp|P87234|GYP3_SCHPO GTPase-activating protein gyp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gyp3 PE=1 SV=1 555 769 2.0E-24
sp|P58802|TB10A_MOUSE TBC1 domain family member 10A OS=Mus musculus GN=Tbc1d10a PE=1 SV=1 559 763 2.0E-24
sp|Q8BHL3|TB10B_MOUSE TBC1 domain family member 10B OS=Mus musculus GN=Tbc1d10b PE=1 SV=2 548 763 2.0E-24
sp|Q8C9V1|TB10C_MOUSE Carabin OS=Mus musculus GN=Tbc1d10c PE=1 SV=1 548 772 2.0E-24
sp|A2AWA9|RBGP1_MOUSE Rab GTPase-activating protein 1 OS=Mus musculus GN=Rabgap1 PE=1 SV=1 551 777 6.0E-24
sp|Q4KMP7|TB10B_HUMAN TBC1 domain family member 10B OS=Homo sapiens GN=TBC1D10B PE=1 SV=3 548 763 6.0E-24
sp|Q9Y3P9|RBGP1_HUMAN Rab GTPase-activating protein 1 OS=Homo sapiens GN=RABGAP1 PE=1 SV=3 551 777 1.0E-23
sp|Q5RAN1|RBGP1_PONAB Rab GTPase-activating protein 1 OS=Pongo abelii GN=RABGAP1 PE=2 SV=1 551 777 1.0E-23
sp|O60347|TBC12_HUMAN TBC1 domain family member 12 OS=Homo sapiens GN=TBC1D12 PE=1 SV=3 494 773 2.0E-23
sp|Q0IHY4|TBC12_XENTR TBC1 domain family member 12 OS=Xenopus tropicalis GN=tbc1d12 PE=2 SV=1 559 773 3.0E-23
sp|Q6A039|TBC12_MOUSE TBC1 domain family member 12 OS=Mus musculus GN=Tbc1d12 PE=1 SV=2 494 773 7.0E-23
sp|Q5RCW6|RBG1L_PONAB Rab GTPase-activating protein 1-like OS=Pongo abelii GN=RABGAP1L PE=2 SV=1 555 777 8.0E-23
sp|A6H6A9|RBG1L_MOUSE Rab GTPase-activating protein 1-like OS=Mus musculus GN=Rabgap1l PE=1 SV=1 555 777 1.0E-22
sp|Q5R372|RBG1L_HUMAN Rab GTPase-activating protein 1-like OS=Homo sapiens GN=RABGAP1L PE=1 SV=1 555 777 1.0E-22
sp|Q09445|GRTP6_CAEEL Growth hormone-regulated TBC protein 6 OS=Caenorhabditis elegans GN=tbc-6 PE=3 SV=3 555 765 7.0E-22
sp|Q96CN4|EVI5L_HUMAN EVI5-like protein OS=Homo sapiens GN=EVI5L PE=1 SV=1 546 773 8.0E-22
sp|O60447|EVI5_HUMAN Ecotropic viral integration site 5 protein homolog OS=Homo sapiens GN=EVI5 PE=1 SV=3 544 773 8.0E-22
sp|Q5ZJ17|RBG1L_CHICK Rab GTPase-activating protein 1-like OS=Gallus gallus GN=RABGAP1L PE=2 SV=1 555 777 1.0E-21
sp|Q12317|MSB4_YEAST GTPase-activating protein MSB4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSB4 PE=1 SV=1 547 771 1.0E-21
sp|Q5CD77|TBC14_RAT TBC1 domain family member 14 OS=Rattus norvegicus GN=Tbc1d14 PE=2 SV=2 494 773 7.0E-20
sp|Q9VYY9|EVI5_DROME Ecotropic viral integration site 5 ortholog OS=Drosophila melanogaster GN=Evi5 PE=1 SV=3 555 776 7.0E-20
sp|Q8CGA2|TBC14_MOUSE TBC1 domain family member 14 OS=Mus musculus GN=Tbc1d14 PE=1 SV=2 524 773 9.0E-20
sp|Q9P2M4|TBC14_HUMAN TBC1 domain family member 14 OS=Homo sapiens GN=TBC1D14 PE=1 SV=3 559 773 1.0E-19
sp|A6H7I8|TBC14_BOVIN TBC1 domain family member 14 OS=Bos taurus GN=TBC1D14 PE=2 SV=2 559 773 5.0E-19
sp|P48566|GYP3_YEAST GTPase-activating protein GYP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSB3 PE=1 SV=1 552 769 3.0E-18
sp|A0A087X179|TBC3E_HUMAN TBC1 domain family member 3E OS=Homo sapiens GN=TBC1D3E PE=2 SV=1 549 769 6.0E-17
sp|A0A087X1G2|TBC3K_HUMAN TBC1 domain family member 3K OS=Homo sapiens GN=TBC1D3K PE=3 SV=1 549 769 8.0E-17
sp|Q755I4|GYP5_ASHGO GTPase-activating protein GYP5 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GYP5 PE=3 SV=2 544 771 9.0E-17
sp|B9A6J9|TBC3L_HUMAN TBC1 domain family member 3L OS=Homo sapiens GN=TBC1D3L PE=2 SV=1 549 769 9.0E-17
sp|A0A087WVF3|TBC3D_HUMAN TBC1 domain family member 3D OS=Homo sapiens GN=TBC1D3D PE=2 SV=1 549 769 9.0E-17
sp|Q6IPX1|TBC3C_HUMAN TBC1 domain family member 3C OS=Homo sapiens GN=TBC1D3C PE=2 SV=3 549 769 9.0E-17
sp|Q8IZP1|TBC3A_HUMAN TBC1 domain family member 3 OS=Homo sapiens GN=TBC1D3 PE=1 SV=6 549 769 9.0E-17
sp|A6NER0|TBC3F_HUMAN TBC1 domain family member 3F OS=Homo sapiens GN=TBC1D3F PE=2 SV=3 549 769 1.0E-16
sp|P0C7X1|TBC3H_HUMAN TBC1 domain family member 3H OS=Homo sapiens GN=TBC1D3H PE=2 SV=3 549 769 2.0E-16
sp|A0A087WXS9|TBC3I_HUMAN TBC1 domain family member 3I OS=Homo sapiens GN=TBC1D3I PE=3 SV=1 549 769 2.0E-16
sp|Q6DHY5|TBC3G_HUMAN TBC1 domain family member 3G OS=Homo sapiens GN=TBC1D3G PE=2 SV=2 549 769 2.0E-16
sp|P35125|UBP6_HUMAN Ubiquitin carboxyl-terminal hydrolase 6 OS=Homo sapiens GN=USP6 PE=1 SV=2 556 771 6.0E-16
sp|O60343|TBCD4_HUMAN TBC1 domain family member 4 OS=Homo sapiens GN=TBC1D4 PE=1 SV=2 538 771 1.0E-15
sp|P97366|EVI5_MOUSE Ecotropic viral integration site 5 protein OS=Mus musculus GN=Evi5 PE=1 SV=2 544 773 2.0E-15
sp|A6NDS4|TBC3B_HUMAN TBC1 domain family member 3B OS=Homo sapiens GN=TBC1D3B PE=2 SV=2 549 769 3.0E-15
sp|Q8BYJ6|TBCD4_MOUSE TBC1 domain family member 4 OS=Mus musculus GN=Tbc1d4 PE=1 SV=2 538 771 2.0E-13
sp|Q60949|TBCD1_MOUSE TBC1 domain family member 1 OS=Mus musculus GN=Tbc1d1 PE=1 SV=3 559 774 2.0E-13
sp|O97790|TBCD1_BOVIN TBC1 domain family member 1 OS=Bos taurus GN=TBC1D1 PE=2 SV=2 559 774 7.0E-13
sp|Q86TI0|TBCD1_HUMAN TBC1 domain family member 1 OS=Homo sapiens GN=TBC1D1 PE=1 SV=2 559 774 2.0E-12
sp|O96904|TBC12_DICDI Drainin OS=Dictyostelium discoideum GN=phgA PE=1 SV=1 600 771 7.0E-12
sp|Q09830|YAD4_SCHPO TBC domain-containing protein C4G8.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4G8.04 PE=1 SV=1 106 183 9.0E-12
sp|Q12344|GYP5_YEAST GTPase-activating protein GYP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GYP5 PE=1 SV=1 552 771 3.0E-11
sp|Q6FWI1|GYP7_CANGA GTPase-activating protein GYP7 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GYP7 PE=3 SV=1 620 767 5.0E-11
sp|Q10496|GYP51_SCHPO GTPase activating protein Gyp51 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gyp51 PE=3 SV=1 549 765 5.0E-11
sp|Q5F361|TBCK_CHICK TBC domain-containing protein kinase-like protein OS=Gallus gallus GN=TBCK PE=2 SV=2 602 775 1.0E-10
sp|Q8TC07|TBC15_HUMAN TBC1 domain family member 15 OS=Homo sapiens GN=TBC1D15 PE=1 SV=2 603 772 2.0E-10
sp|Q8BM85|TBCK_MOUSE TBC domain-containing protein kinase-like protein OS=Mus musculus GN=Tbck PE=1 SV=1 602 775 2.0E-10
sp|P09379|GYP7_YARLI GTPase-activating protein GYP7 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GYP7 PE=3 SV=2 600 762 3.0E-10
sp|Q9CXF4|TBC15_MOUSE TBC1 domain family member 15 OS=Mus musculus GN=Tbc1d15 PE=1 SV=1 603 772 4.0E-10
sp|Q8TEA7|TBCK_HUMAN TBC domain-containing protein kinase-like protein OS=Homo sapiens GN=TBCK PE=1 SV=4 602 775 4.0E-10
sp|Q86UD7|TBC26_HUMAN TBC1 domain family member 26 OS=Homo sapiens GN=TBC1D26 PE=2 SV=3 547 671 4.0E-10
sp|Q9HA65|TBC17_HUMAN TBC1 domain family member 17 OS=Homo sapiens GN=TBC1D17 PE=1 SV=2 603 770 5.0E-09
sp|Q8BYH7|TBC17_MOUSE TBC1 domain family member 17 OS=Mus musculus GN=Tbc1d17 PE=1 SV=2 603 770 2.0E-08
sp|Q8TBP0|TBC16_HUMAN TBC1 domain family member 16 OS=Homo sapiens GN=TBC1D16 PE=2 SV=1 553 772 5.0E-08
sp|Q9Y7J5|YOI9_SCHPO TBC domain-containing protein C1778.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1778.09 PE=3 SV=1 557 745 6.0E-08
sp|Q9UUH7|GYP7_SCHPO GTPase-activating protein gyp7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gyp7 PE=3 SV=1 602 761 6.0E-07
sp|Q55G97|TBCK_DICDI TBC domain-containing protein kinase-like protein OS=Dictyostelium discoideum GN=tbck PE=3 SV=1 560 765 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 69 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2909
MDGSSECNSVTRSVSQSSAQSQHSTRRTSRTCKAVSHGSSSASSTTASDKSLTSFPSFSPANGSRQGLGDVDSQG
PKTATQEAHEGEAGGSAGGPCIVDSLTGPTCGREALFEDTPLRQSIPGALHQADDGHIERLVARHGAVALVRRIA
EDLAVRDSQMAALRRRADERERALRRIVRECGLSNLHLEGRLRAVEQELRCRDEAGPGQGEGEGEGEGLRGLMSE
AMQNTLASEGGGEARTETLGEANGEAGTETLGETLGRAATVRASAETTAKRPLKGWKGYLWGSSRTDTQQATGSG
SDASSMDSGSAGERKTSTWLGSLALRLVAGRPRALEAMERSSSAKESYGPVEMDAILPPESQPPTLSHLYQTSNS
SLLTDRFGFIYDERRKKRQREAAEVAQQGSAPAWQDHVPTTTGPTELLSHTPSMKATQGGLVPLASPTTRAVDSM
ADGARAQHHAEPVRLLLAQLSEAHDSQQRDKTAKWNDFLRKVRAERRREGQAAAAAAAQAAQARFQQPAEMLPET
RVADGEVVGIAGLGIKGKVGRAKWSEFKALVLAGIPVAYRSKLWSECSGATALRLPGYYADLLARSRPHDDALVM
AQIQMDIHRTLTDNIFFRNGPGVDKLNHVLVAYSRRNPEVGYCQGMNLIAANLLLVMASAEDAFWVLASMIEKML
PRAYYDQSLMASRADQQVLRHYVATLLPRLSAHLDALAIELEALTFQWFLSVFTDCLSAEALFRVWDVLLCTNDG
ATFMFQVALALLKLNEANLLQRDTPAAH*
Coding >OphauB2|2909
ATGGACGGCTCGTCCGAGTGCAATTCTGTGACGCGCTCAGTCTCGCAGAGCAGCGCGCAGTCACAGCACAGCACG
CGGCGGACCAGCAGGACATGCAAAGCGGTGTCGCATGGCAGCAGCTCGGCCAGCAGCACGACGGCCAGCGACAAG
TCGTTGACGAGCTTCCCCAGCTTTTCGCCGGCAAATGGCTCGCGTCAAGGCTTGGGCGACGTGGACAGCCAAGGG
CCCAAGACGGCGACGCAAGAGGCGCACGAGGGCGAGGCAGGAGGGAGCGCAGGCGGGCCCTGCATTGTGGACAGC
CTCACGGGGCCGACGTGTGGGCGAGAAGCGCTGTTTGAAGACACGCCGCTGCGGCAGTCGATCCCGGGCGCTCTG
CACCAGGCGGACGACGGGCACATTGAGCGACTGGTGGCGCGGCACGGGGCTGTGGCGCTGGTGCGCCGCATTGCC
GAGGACTTGGCTGTGCGCGACAGCCAGATGGCGGCGCTGCGGCGGCGGGCCGACGAGCGGGAGCGTGCTCTGCGG
CGCATTGTGCGTGAGTGCGGCCTGTCCAATCTGCATCTAGAAGGGCGTCTGCGCGCCGTAGAGCAGGAGCTGCGG
TGCAGGGACGAGGCGGGACCGGGGCAGGGCGAGGGCGAGGGCGAGGGCGAGGGCCTGAGAGGGCTCATGAGCGAA
GCCATGCAAAACACGCTGGCCAGTGAGGGGGGTGGCGAGGCGCGTACAGAGACACTTGGCGAGGCGAATGGCGAG
GCGGGTACAGAGACACTTGGCGAGACACTTGGCAGGGCGGCCACGGTGCGCGCGTCGGCCGAAACGACTGCCAAG
AGGCCTCTCAAGGGCTGGAAGGGCTATCTCTGGGGCAGCAGCCGCACGGACACGCAGCAGGCCACGGGCAGCGGC
AGCGACGCATCCAGCATGGACTCGGGCAGTGCTGGCGAGCGCAAGACGTCGACGTGGCTGGGCAGCCTGGCGCTG
CGGCTGGTGGCGGGCAGGCCCAGGGCGCTCGAGGCCATGGAGCGCTCCAGCAGCGCCAAGGAGAGCTACGGGCCG
GTGGAGATGGATGCCATCCTGCCGCCCGAGTCGCAGCCGCCGACGCTGTCGCACCTATACCAGACGAGCAACAGC
AGCCTGCTGACGGACCGCTTCGGCTTCATCTACGACGAGCGGCGCAAGAAGCGGCAGCGCGAGGCGGCCGAGGTG
GCACAGCAGGGCAGCGCGCCGGCCTGGCAAGACCATGTGCCGACGACGACGGGGCCCACGGAGCTGCTCAGCCAC
ACGCCCAGCATGAAGGCCACCCAGGGCGGTCTGGTGCCGCTGGCCAGCCCGACAACCAGGGCCGTGGACAGCATG
GCCGACGGCGCTCGGGCGCAGCACCACGCTGAGCCGGTGCGGCTGCTGCTGGCCCAGCTCAGCGAGGCGCACGAC
TCACAGCAGCGCGACAAGACGGCCAAGTGGAACGACTTCCTGCGCAAGGTGCGGGCGGAGCGCCGGCGCGAGGGC
CAGGCGGCGGCAGCGGCGGCAGCCCAGGCGGCCCAGGCGCGCTTCCAGCAGCCGGCCGAGATGCTGCCCGAGACG
CGCGTGGCCGACGGCGAGGTGGTGGGCATCGCCGGCCTGGGCATCAAGGGCAAGGTGGGCCGCGCCAAGTGGTCC
GAGTTCAAGGCCCTGGTGCTGGCCGGCATCCCCGTCGCCTACCGCTCCAAGCTGTGGTCCGAATGCTCGGGCGCC
ACCGCCCTGCGCCTCCCCGGCTACTACGCCGACCTGCTGGCCCGCAGCCGCCCCCACGACGATGCCCTCGTCATG
GCCCAGATCCAAATGGACATCCACCGCACCCTGACGGACAACATCTTCTTCCGCAACGGCCCCGGCGTCGACAAG
CTCAACCACGTCCTCGTCGCCTACTCGCGCCGCAACCCCGAGGTCGGCTACTGCCAGGGCATGAACCTCATTGCC
GCCAACCTGCTGCTCGTCATGGCCTCGGCCGAGGACGCCTTTTGGGTCCTGGCCTCCATGATTGAGAAGATGCTG
CCCCGCGCCTACTACGACCAGTCCCTCATGGCCTCGCGCGCCGACCAGCAGGTCCTGCGCCACTACGTCGCCACC
CTCCTGCCGCGCCTCTCGGCCCACCTCGATGCTCTGGCCATTGAGCTCGAGGCCCTGACCTTTCAGTGGTTCCTC
TCCGTCTTTACCGACTGCCTGTCTGCCGAGGCCCTCTTTCGCGTCTGGGACGTGCTTCTGTGCACCAATGACGGC
GCCACCTTTATGTTCCAGGTGGCCCTGGCCCTGCTCAAGCTCAACGAGGCCAATCTGCTGCAGCGCGACACCCCA
GCCGCCCATTGA
Transcript >OphauB2|2909
ATGGACGGCTCGTCCGAGTGCAATTCTGTGACGCGCTCAGTCTCGCAGAGCAGCGCGCAGTCACAGCACAGCACG
CGGCGGACCAGCAGGACATGCAAAGCGGTGTCGCATGGCAGCAGCTCGGCCAGCAGCACGACGGCCAGCGACAAG
TCGTTGACGAGCTTCCCCAGCTTTTCGCCGGCAAATGGCTCGCGTCAAGGCTTGGGCGACGTGGACAGCCAAGGG
CCCAAGACGGCGACGCAAGAGGCGCACGAGGGCGAGGCAGGAGGGAGCGCAGGCGGGCCCTGCATTGTGGACAGC
CTCACGGGGCCGACGTGTGGGCGAGAAGCGCTGTTTGAAGACACGCCGCTGCGGCAGTCGATCCCGGGCGCTCTG
CACCAGGCGGACGACGGGCACATTGAGCGACTGGTGGCGCGGCACGGGGCTGTGGCGCTGGTGCGCCGCATTGCC
GAGGACTTGGCTGTGCGCGACAGCCAGATGGCGGCGCTGCGGCGGCGGGCCGACGAGCGGGAGCGTGCTCTGCGG
CGCATTGTGCGTGAGTGCGGCCTGTCCAATCTGCATCTAGAAGGGCGTCTGCGCGCCGTAGAGCAGGAGCTGCGG
TGCAGGGACGAGGCGGGACCGGGGCAGGGCGAGGGCGAGGGCGAGGGCGAGGGCCTGAGAGGGCTCATGAGCGAA
GCCATGCAAAACACGCTGGCCAGTGAGGGGGGTGGCGAGGCGCGTACAGAGACACTTGGCGAGGCGAATGGCGAG
GCGGGTACAGAGACACTTGGCGAGACACTTGGCAGGGCGGCCACGGTGCGCGCGTCGGCCGAAACGACTGCCAAG
AGGCCTCTCAAGGGCTGGAAGGGCTATCTCTGGGGCAGCAGCCGCACGGACACGCAGCAGGCCACGGGCAGCGGC
AGCGACGCATCCAGCATGGACTCGGGCAGTGCTGGCGAGCGCAAGACGTCGACGTGGCTGGGCAGCCTGGCGCTG
CGGCTGGTGGCGGGCAGGCCCAGGGCGCTCGAGGCCATGGAGCGCTCCAGCAGCGCCAAGGAGAGCTACGGGCCG
GTGGAGATGGATGCCATCCTGCCGCCCGAGTCGCAGCCGCCGACGCTGTCGCACCTATACCAGACGAGCAACAGC
AGCCTGCTGACGGACCGCTTCGGCTTCATCTACGACGAGCGGCGCAAGAAGCGGCAGCGCGAGGCGGCCGAGGTG
GCACAGCAGGGCAGCGCGCCGGCCTGGCAAGACCATGTGCCGACGACGACGGGGCCCACGGAGCTGCTCAGCCAC
ACGCCCAGCATGAAGGCCACCCAGGGCGGTCTGGTGCCGCTGGCCAGCCCGACAACCAGGGCCGTGGACAGCATG
GCCGACGGCGCTCGGGCGCAGCACCACGCTGAGCCGGTGCGGCTGCTGCTGGCCCAGCTCAGCGAGGCGCACGAC
TCACAGCAGCGCGACAAGACGGCCAAGTGGAACGACTTCCTGCGCAAGGTGCGGGCGGAGCGCCGGCGCGAGGGC
CAGGCGGCGGCAGCGGCGGCAGCCCAGGCGGCCCAGGCGCGCTTCCAGCAGCCGGCCGAGATGCTGCCCGAGACG
CGCGTGGCCGACGGCGAGGTGGTGGGCATCGCCGGCCTGGGCATCAAGGGCAAGGTGGGCCGCGCCAAGTGGTCC
GAGTTCAAGGCCCTGGTGCTGGCCGGCATCCCCGTCGCCTACCGCTCCAAGCTGTGGTCCGAATGCTCGGGCGCC
ACCGCCCTGCGCCTCCCCGGCTACTACGCCGACCTGCTGGCCCGCAGCCGCCCCCACGACGATGCCCTCGTCATG
GCCCAGATCCAAATGGACATCCACCGCACCCTGACGGACAACATCTTCTTCCGCAACGGCCCCGGCGTCGACAAG
CTCAACCACGTCCTCGTCGCCTACTCGCGCCGCAACCCCGAGGTCGGCTACTGCCAGGGCATGAACCTCATTGCC
GCCAACCTGCTGCTCGTCATGGCCTCGGCCGAGGACGCCTTTTGGGTCCTGGCCTCCATGATTGAGAAGATGCTG
CCCCGCGCCTACTACGACCAGTCCCTCATGGCCTCGCGCGCCGACCAGCAGGTCCTGCGCCACTACGTCGCCACC
CTCCTGCCGCGCCTCTCGGCCCACCTCGATGCTCTGGCCATTGAGCTCGAGGCCCTGACCTTTCAGTGGTTCCTC
TCCGTCTTTACCGACTGCCTGTCTGCCGAGGCCCTCTTTCGCGTCTGGGACGTGCTTCTGTGCACCAATGACGGC
GCCACCTTTATGTTCCAGGTGGCCCTGGCCCTGCTCAAGCTCAACGAGGCCAATCTGCTGCAGCGCGACACCCCA
GCCGCCCATTGA
Gene >OphauB2|2909
ATGGACGGCTCGTCCGAGTGCAATTCTGTGACGCGCTCAGTCTCGCAGAGCAGCGCGCAGTCACAGCACAGCACG
CGGCGGACCAGCAGGACATGCAAAGCGGTGTCGCATGGCAGCAGCTCGGCCAGCAGCACGACGGCCAGCGACAAG
TCGTTGACGAGCTTCCCCAGCTTTTCGCCGGCAAATGGCTCGCGTCAAGGCTTGGGCGACGTGGACAGCCAAGGG
CCCAAGACGGCGACGCAAGAGGCGCACGAGGGCGAGGCAGGAGGGAGCGCAGGCGGGCCCTGCATTGTGGACAGC
CTCACGGGGCCGACGTGTGGGCGAGAAGCGCTGTTTGAAGACACGCCGCTGCGGCAGTCGATCCCGGGCGCTCTG
CACCAGGCGGACGACGGGCACATTGAGCGACTGGTGGCGCGGCACGGGGCTGTGGCGCTGGTGCGCCGCATTGCC
GAGGACTTGGCTGTGCGCGACAGCCAGATGGCGGCGCTGCGGCGGCGGGCCGACGAGCGGGAGCGTGCTCTGCGG
CGCATTGTGCGTGAGTGCGGCCTGTCCAATCTGCATCTAGAAGGGCGTCTGCGCGCCGTAGAGCAGGAGCTGCGG
TGCAGGGACGAGGCGGGACCGGGGCAGGGCGAGGGCGAGGGCGAGGGCGAGGGCCTGAGAGGGCTCATGAGCGAA
GCCATGCAAAACACGCTGGCCAGTGAGGGGGGTGGCGAGGCGCGTACAGAGACACTTGGCGAGGCGAATGGCGAG
GCGGGTACAGAGACACTTGGCGAGACACTTGGCAGGGCGGCCACGGTGCGCGCGTCGGCCGAAACGACTGCCAAG
AGGCCTCTCAAGGGCTGGAAGGGCTATCTCTGGGGCAGCAGCCGCACGGACACGCAGCAGGCCACGGGCAGCGGC
AGCGACGCATCCAGCATGGACTCGGGCAGTGCTGGCGAGCGCAAGACGTCGACGTGGCTGGGCAGCCTGGCGCTG
CGGCTGGTGGCGGGCAGGCCCAGGGCGCTCGAGGCCATGGAGCGCTCCAGCAGCGCCAAGGAGAGCTACGGGCCG
GTGGAGATGGATGCCATCCTGCCGCCCGAGTCGCAGCCGCCGACGCTGTCGCACCTATACCAGACGAGCAACAGC
AGCCTGCTGACGGACCGCTTCGGCTTCATCTACGACGAGCGGCGCAAGAAGCGGCAGCGCGAGGCGGCCGAGGTG
GCACAGCAGGGCAGCGCGCCGGCCTGGCAAGACCATGTGCCGACGACGACGGGGCCCACGGAGCTGCTCAGCCAC
ACGCCCAGCATGAAGGCCACCCAGGGCGGTCTGGTGCCGCTGGCCAGCCCGACAACCAGGGCCGTGGACAGCATG
GCCGACGGCGCTCGGGCGCAGCACCACGCTGAGCCGGTGCGGCTGCTGCTGGCCCAGCTCAGCGAGGCGCACGAC
TCACAGCAGCGCGACAAGACGGCCAAGTGGAACGACTTCCTGCGCAAGGTGCGGGCGGAGCGCCGGCGCGAGGGC
CAGGCGGCGGCAGCGGCGGCAGCCCAGGCGGCCCAGGCGCGCTTCCAGCAGCCGGCCGAGATGCTGCCCGAGACG
CGCGTGGCCGACGGCGAGGTGGTGGGCATCGCCGGCCTGGGCATCAAGGGCAAGGTGGGCCGCGCCAAGTGGTCC
GAGTTCAAGGCCCTGGTGCTGGCCGGCATCCCCGTCGCCTACCGCTCCAAGCTGTGGTCCGAATGCTCGGGCGCC
ACCGCCCTGCGCCTCCCCGGCTACTACGCCGACCTGCTGGCCCGCAGCCGCCCCCACGACGATGCCCTCGTCATG
GCCCAGATCCAAATGGACATCCACCGCACCCTGACGGACAACATCTTCTTCCGCAACGGCCCCGGCGTCGACAAG
CTCAACCACGTCCTCGTCGCCTACTCGCGCCGCAACCCCGAGGTCGGCTACTGCCAGGGCATGAACCTCATTGCC
GCCAACCTGCTGCTCGTCATGGCCTCGGCCGAGGACGCCTTTTGGGTCCTGGCCTCCATGATTGAGAAGATGCTG
CCCCGCGCCTACTACGACCAGTCCCTCATGGCCTCGCGCGCCGACCAGCAGGTCCTGCGCCACTACGTCGCCACC
CTCCTGCCGCGCCTCTCGGCCCACCTCGATGCTCTGGCCATTGAGCTCGAGGCCCTGACCTTTCAGTGGTTCCTC
TCCGTCTTTACCGACTGCCTGTCTGCCGAGGCCCTCTTTCGCGTCTGGGACGTGCTTCTGTGCACCAATGACGGC
GCCACCTTTATGTTCCAGGTGGCCCTGGCCCTGCTCAAGCTCAACGAGGCCAATCTGCTGCAGCGCGACACCCCA
GCCGCCGTCTACACCTACATTAGCCACCACATGACGGAGCATGCCATTAGCATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail