Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2906
Gene name
LocationContig_2:5134..5953
Strand+
Gene length (bp)819
Transcript length (bp)819
Coding sequence length (bp)819
Protein length (aa) 273

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13847 Methyltransf_31 Methyltransferase domain 7.8E-28 41 165
PF08241 Methyltransf_11 Methyltransferase domain 5.1E-22 45 142
PF13649 Methyltransf_25 Methyltransferase domain 3.9E-21 44 139
PF01209 Ubie_methyltran ubiE/COQ5 methyltransferase family 1.1E-16 24 167
PF13489 Methyltransf_23 Methyltransferase domain 1.3E-13 33 193
PF08242 Methyltransf_12 Methyltransferase domain 3.9E-13 45 140
PF07021 MetW Methionine biosynthesis protein MetW 2.1E-07 34 137
PF01135 PCMT Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) 1.3E-06 27 101
PF05175 MTS Methyltransferase small domain 1.4E-06 31 112

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13871|YE16_SCHPO Uncharacterized methyltransferase C1B3.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1B3.06c PE=3 SV=1 10 272 3.0E-45
sp|P20187|YT37_STRFR Uncharacterized 37.1 kDa protein in transposon TN4556 OS=Streptomyces fradiae PE=3 SV=1 39 249 6.0E-17
sp|P67063|MENG_STAAW Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain MW2) GN=menG PE=3 SV=1 38 217 4.0E-14
sp|A8Z450|MENG_STAAT Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=menG PE=3 SV=1 38 217 4.0E-14
sp|Q6G992|MENG_STAAS Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain MSSA476) GN=menG PE=3 SV=1 38 217 4.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13871|YE16_SCHPO Uncharacterized methyltransferase C1B3.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1B3.06c PE=3 SV=1 10 272 3.0E-45
sp|P20187|YT37_STRFR Uncharacterized 37.1 kDa protein in transposon TN4556 OS=Streptomyces fradiae PE=3 SV=1 39 249 6.0E-17
sp|P67063|MENG_STAAW Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain MW2) GN=menG PE=3 SV=1 38 217 4.0E-14
sp|A8Z450|MENG_STAAT Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=menG PE=3 SV=1 38 217 4.0E-14
sp|Q6G992|MENG_STAAS Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain MSSA476) GN=menG PE=3 SV=1 38 217 4.0E-14
sp|P67062|MENG_STAAN Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain N315) GN=menG PE=1 SV=1 38 217 4.0E-14
sp|P67061|MENG_STAAM Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=menG PE=3 SV=1 38 217 4.0E-14
sp|A6QH20|MENG_STAAE Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain Newman) GN=menG PE=3 SV=1 38 217 4.0E-14
sp|Q5HFV2|MENG_STAAC Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain COL) GN=menG PE=3 SV=1 38 217 4.0E-14
sp|A5ISZ9|MENG_STAA9 Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain JH9) GN=menG PE=3 SV=1 38 217 4.0E-14
sp|A6U1T9|MENG_STAA2 Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain JH1) GN=menG PE=3 SV=1 38 217 4.0E-14
sp|A7X2H6|MENG_STAA1 Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=menG PE=3 SV=1 38 217 4.0E-14
sp|Q2YY85|MENG_STAAB Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=menG PE=3 SV=1 38 217 4.0E-14
sp|Q6GGU0|MENG_STAAR Demethylmenaquinone methyltransferase OS=Staphylococcus aureus (strain MRSA252) GN=menG PE=3 SV=1 38 217 9.0E-14
sp|A7NF26|MENG_ROSCS Demethylmenaquinone methyltransferase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=menG PE=3 SV=1 22 148 5.0E-13
sp|Q4L6H3|MENG_STAHJ Demethylmenaquinone methyltransferase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=menG PE=3 SV=1 37 217 8.0E-13
sp|B9DNV5|MENG_STACT Demethylmenaquinone methyltransferase OS=Staphylococcus carnosus (strain TM300) GN=menG PE=3 SV=1 37 217 4.0E-12
sp|Q8CSH9|MENG_STAES Demethylmenaquinone methyltransferase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=menG PE=3 SV=1 37 193 6.0E-12
sp|Q5HP74|MENG_STAEQ Demethylmenaquinone methyltransferase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=menG PE=3 SV=1 37 193 6.0E-12
sp|O86169|MENG_GEOSE Demethylmenaquinone methyltransferase OS=Geobacillus stearothermophilus GN=menG PE=3 SV=1 37 169 9.0E-12
sp|B8DBZ5|MENG_LISMH Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=menG PE=3 SV=1 38 193 2.0E-11
sp|B7GHP8|MENG_ANOFW Demethylmenaquinone methyltransferase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=menG PE=3 SV=1 37 167 3.0E-11
sp|P49016|MENG_LACLA Demethylmenaquinone methyltransferase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=menG PE=3 SV=1 41 167 3.0E-11
sp|P67055|MENG_LISMO Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=menG PE=3 SV=1 38 193 1.0E-10
sp|Q71Y84|MENG_LISMF Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=menG PE=3 SV=1 38 193 1.0E-10
sp|C1KWN1|MENG_LISMC Demethylmenaquinone methyltransferase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=menG PE=3 SV=1 38 193 1.0E-10
sp|P67056|MENG_LISIN Demethylmenaquinone methyltransferase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=menG PE=3 SV=1 38 193 1.0E-10
sp|P31113|MENG_BACSU Demethylmenaquinone methyltransferase OS=Bacillus subtilis (strain 168) GN=menG PE=1 SV=1 35 167 1.0E-10
sp|Q8KZ94|REBMT_NOCAE Demethylrebeccamycin-D-glucose O-methyltransferase OS=Lechevalieria aerocolonigenes GN=rebM PE=1 SV=1 38 144 2.0E-10
sp|A0AK43|MENG_LISW6 Demethylmenaquinone methyltransferase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=menG PE=3 SV=1 38 169 3.0E-10
sp|Q5KXU0|MENG_GEOKA Demethylmenaquinone methyltransferase OS=Geobacillus kaustophilus (strain HTA426) GN=menG PE=3 SV=1 37 169 3.0E-10
sp|C5D3E5|MENG_GEOSW Demethylmenaquinone methyltransferase OS=Geobacillus sp. (strain WCH70) GN=menG PE=3 SV=1 37 169 3.0E-10
sp|Q67LE6|MENG_SYMTH Demethylmenaquinone methyltransferase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=menG PE=3 SV=1 37 153 4.0E-10
sp|Q6ZIX2|SMT1_ORYSJ Cycloartenol-C-24-methyltransferase 1 OS=Oryza sativa subsp. japonica GN=Smt1-1 PE=2 SV=1 38 136 5.0E-10
sp|Q9XAP8|MENG_STRCO Demethylmenaquinone methyltransferase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=menG PE=3 SV=1 39 154 7.0E-10
sp|Q49XS5|MENG_STAS1 Demethylmenaquinone methyltransferase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=menG PE=3 SV=1 37 220 7.0E-10
sp|O31474|YCGJ_BACSU Uncharacterized methyltransferase YcgJ OS=Bacillus subtilis (strain 168) GN=ycgJ PE=1 SV=2 39 139 1.0E-09
sp|Q87TH4|UBIE_VIBPA Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=ubiE PE=3 SV=1 39 159 1.0E-09
sp|A7Z627|MENG_BACMF Demethylmenaquinone methyltransferase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=menG PE=3 SV=1 35 148 1.0E-09
sp|Q9P3R1|ERG6_NEUCR Sterol 24-C-methyltransferase erg-4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=erg-4 PE=3 SV=1 38 174 2.0E-09
sp|A1SAJ8|UBIE_SHEAM Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=ubiE PE=3 SV=1 39 147 2.0E-09
sp|Q6MHQ3|UBIE_BDEBA Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=ubiE PE=3 SV=1 43 142 2.0E-09
sp|A7GN50|MENG_BACCN Demethylmenaquinone methyltransferase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=menG PE=3 SV=1 20 151 2.0E-09
sp|Q5WGT4|MENG_BACSK Demethylmenaquinone methyltransferase OS=Bacillus clausii (strain KSM-K16) GN=menG PE=3 SV=1 10 173 3.0E-09
sp|B0TJ16|UBIE_SHEHH Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella halifaxensis (strain HAW-EB4) GN=ubiE PE=3 SV=1 39 147 6.0E-09
sp|A7MTX1|UBIE_VIBCB Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=ubiE PE=3 SV=1 39 162 6.0E-09
sp|A8FEK9|MENG_BACP2 Demethylmenaquinone methyltransferase OS=Bacillus pumilus (strain SAFR-032) GN=menG PE=3 SV=1 37 148 7.0E-09
sp|Q8E9R7|UBIE_SHEON Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella oneidensis (strain MR-1) GN=ubiE PE=3 SV=1 39 147 8.0E-09
sp|Q73AY2|MENG_BACC1 Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=menG PE=3 SV=1 20 151 1.0E-08
sp|A5UVB2|MENG_ROSS1 Demethylmenaquinone methyltransferase OS=Roseiflexus sp. (strain RS-1) GN=menG PE=3 SV=1 43 148 1.0E-08
sp|A9VMC2|MENG_BACWK Demethylmenaquinone methyltransferase OS=Bacillus weihenstephanensis (strain KBAB4) GN=menG PE=3 SV=1 20 151 2.0E-08
sp|A1RP78|UBIE_SHESW Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella sp. (strain W3-18-1) GN=ubiE PE=3 SV=1 39 147 2.0E-08
sp|A4Y2Q5|UBIE_SHEPC Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=ubiE PE=3 SV=1 39 147 2.0E-08
sp|A9KYL8|UBIE_SHEB9 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella baltica (strain OS195) GN=ubiE PE=3 SV=1 39 147 2.0E-08
sp|A6WIE9|UBIE_SHEB8 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella baltica (strain OS185) GN=ubiE PE=3 SV=1 39 147 2.0E-08
sp|A3D9F2|UBIE_SHEB5 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=ubiE PE=3 SV=1 39 147 2.0E-08
sp|A6VTA1|UBIE_MARMS Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Marinomonas sp. (strain MWYL1) GN=ubiE PE=3 SV=1 38 159 2.0E-08
sp|Q7MQ33|UBIE_VIBVY Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Vibrio vulnificus (strain YJ016) GN=ubiE PE=3 SV=1 39 162 2.0E-08
sp|Q8DDP9|UBIE_VIBVU Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Vibrio vulnificus (strain CMCP6) GN=ubiE PE=3 SV=1 39 162 2.0E-08
sp|B8E6B6|UBIE_SHEB2 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella baltica (strain OS223) GN=ubiE PE=3 SV=1 39 147 2.0E-08
sp|Q088H8|UBIE_SHEFN Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella frigidimarina (strain NCIMB 400) GN=ubiE PE=3 SV=1 39 148 2.0E-08
sp|Q74LY0|MENG_LACJO Demethylmenaquinone methyltransferase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=menG PE=3 SV=1 45 141 2.0E-08
sp|O66128|MENG_MICLU Demethylmenaquinone methyltransferase OS=Micrococcus luteus GN=menG PE=3 SV=1 37 193 2.0E-08
sp|Q6HL42|MENG_BACHK Demethylmenaquinone methyltransferase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=menG PE=3 SV=1 20 151 2.0E-08
sp|Q63DL9|MENG_BACCZ Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain ZK / E33L) GN=menG PE=3 SV=1 20 151 2.0E-08
sp|B9IVN5|MENG_BACCQ Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain Q1) GN=menG PE=3 SV=1 20 151 2.0E-08
sp|B7HL23|MENG_BACC7 Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain AH187) GN=menG PE=3 SV=1 20 151 2.0E-08
sp|C1EN10|MENG_BACC3 Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain 03BB102) GN=menG PE=3 SV=1 20 151 2.0E-08
sp|B7JGZ8|MENG_BACC0 Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain AH820) GN=menG PE=3 SV=1 20 151 2.0E-08
sp|Q81SW0|MENG_BACAN Demethylmenaquinone methyltransferase OS=Bacillus anthracis GN=menG PE=3 SV=1 20 151 2.0E-08
sp|C3L8S6|MENG_BACAC Demethylmenaquinone methyltransferase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=menG PE=3 SV=1 20 151 2.0E-08
sp|C3P5A0|MENG_BACAA Demethylmenaquinone methyltransferase OS=Bacillus anthracis (strain A0248) GN=menG PE=3 SV=1 20 151 2.0E-08
sp|Q6C2D9|ERG6_YARLI Sterol 24-C-methyltransferase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ERG6 PE=3 SV=1 38 174 3.0E-08
sp|B1HTA6|MENG_LYSSC Demethylmenaquinone methyltransferase OS=Lysinibacillus sphaericus (strain C3-41) GN=menG PE=3 SV=1 38 148 3.0E-08
sp|B5EFL1|UBIE_GEOBB Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=ubiE PE=3 SV=1 43 148 4.0E-08
sp|A1S6C9|UBIG_SHEAM Ubiquinone biosynthesis O-methyltransferase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=ubiG PE=3 SV=1 43 133 5.0E-08
sp|A3PUJ1|MENG_MYCSJ Demethylmenaquinone methyltransferase OS=Mycobacterium sp. (strain JLS) GN=menG PE=3 SV=1 24 194 5.0E-08
sp|A8H966|UBIE_SHEPA Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=ubiE PE=3 SV=1 39 147 6.0E-08
sp|Q9RRT0|MENG_DEIRA Demethylmenaquinone methyltransferase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=menG PE=3 SV=1 43 142 7.0E-08
sp|B1KR07|UBIE_SHEWM Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=ubiE PE=3 SV=1 39 147 9.0E-08
sp|Q9KCC4|MENG_BACHD Demethylmenaquinone methyltransferase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=menG PE=3 SV=1 37 151 1.0E-07
sp|A8G0S7|UBIE_SHESH Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella sediminis (strain HAW-EB3) GN=ubiE PE=3 SV=1 39 147 1.0E-07
sp|Q21FY5|BIOHC_SACD2 Biotin biosynthesis bifunctional protein BioHC OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=bioC PE=3 SV=1 28 203 1.0E-07
sp|A3PNM3|UBIG_RHOS1 Ubiquinone biosynthesis O-methyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=ubiG PE=3 SV=1 42 144 1.0E-07
sp|Q12S23|UBIE_SHEDO Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=ubiE PE=3 SV=1 39 147 1.0E-07
sp|Q0HZP7|UBIE_SHESR Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella sp. (strain MR-7) GN=ubiE PE=3 SV=1 39 147 1.0E-07
sp|Q0HEA1|UBIE_SHESM Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella sp. (strain MR-4) GN=ubiE PE=3 SV=1 39 147 1.0E-07
sp|A0L1M4|UBIE_SHESA Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella sp. (strain ANA-3) GN=ubiE PE=3 SV=1 39 147 1.0E-07
sp|Q1BE01|MENG_MYCSS Demethylmenaquinone methyltransferase OS=Mycobacterium sp. (strain MCS) GN=menG PE=3 SV=1 24 194 1.0E-07
sp|A1UAY5|MENG_MYCSK Demethylmenaquinone methyltransferase OS=Mycobacterium sp. (strain KMS) GN=menG PE=3 SV=1 24 194 1.0E-07
sp|O52025|ARSM_HALSA Putative arsenite methyltransferase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=arsM PE=2 SV=1 40 154 1.0E-07
sp|A4WW91|UBIG_RHOS5 Ubiquinone biosynthesis O-methyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=ubiG PE=3 SV=1 42 144 1.0E-07
sp|Q81FQ6|MENG_BACCR Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=menG PE=3 SV=1 20 151 1.0E-07
sp|B7HHR7|MENG_BACC4 Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain B4264) GN=menG PE=3 SV=1 20 151 1.0E-07
sp|B7IP91|MENG_BACC2 Demethylmenaquinone methyltransferase OS=Bacillus cereus (strain G9842) GN=menG PE=3 SV=1 20 151 1.0E-07
sp|Q5QYG2|UBIE_IDILO Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=ubiE PE=3 SV=1 24 147 1.0E-07
sp|Q818X2|BIOC_BACCR Malonyl-[acyl-carrier protein] O-methyltransferase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=bioC PE=3 SV=1 41 119 1.0E-07
sp|C3LPS5|UBIE_VIBCM Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Vibrio cholerae serotype O1 (strain M66-2) GN=ubiE PE=3 SV=1 39 159 2.0E-07
sp|Q9KVQ6|UBIE_VIBCH Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=ubiE PE=3 SV=1 39 159 2.0E-07
sp|A5F4E5|UBIE_VIBC3 Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=ubiE PE=3 SV=1 39 159 2.0E-07
sp|B9KPP7|UBIG_RHOSK Ubiquinone biosynthesis O-methyltransferase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=ubiG PE=3 SV=1 42 144 2.0E-07
sp|A4JHS6|UBIE_BURVG Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=ubiE PE=3 SV=1 37 162 2.0E-07
sp|C5BRL2|UBIE_TERTT Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=ubiE PE=3 SV=1 38 147 2.0E-07
sp|B8CI06|UBIE_SHEPW Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=ubiE PE=3 SV=1 39 147 2.0E-07
sp|Q88SI6|MENG_LACPL Demethylmenaquinone methyltransferase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=menG PE=3 SV=1 37 148 3.0E-07
sp|A3QIE1|UBIE_SHELP Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=ubiE PE=3 SV=1 39 147 3.0E-07
sp|D8MPW4|BIOC_ERWBE Malonyl-[acyl-carrier protein] O-methyltransferase OS=Erwinia billingiae (strain Eb661) GN=bioC PE=3 SV=1 39 148 3.0E-07
sp|A4SM99|UBIG_AERS4 Ubiquinone biosynthesis O-methyltransferase OS=Aeromonas salmonicida (strain A449) GN=ubiG PE=3 SV=1 43 141 3.0E-07
sp|P94298|MENG_BACPE Demethylmenaquinone methyltransferase OS=Bacillus pseudofirmus (strain OF4) GN=menG PE=3 SV=2 38 151 3.0E-07
sp|Q3IYM5|UBIG_RHOS4 Ubiquinone biosynthesis O-methyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=ubiG PE=3 SV=1 42 144 3.0E-07
sp|Q81ZX2|MENG_STRAW Demethylmenaquinone methyltransferase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=menG PE=3 SV=1 39 154 4.0E-07
sp|Q1GC56|UBIE_RUEST Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Ruegeria sp. (strain TM1040) GN=ubiE PE=3 SV=1 39 147 4.0E-07
sp|C6E4U6|UBIE_GEOSM Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Geobacter sp. (strain M21) GN=ubiE PE=3 SV=1 41 148 5.0E-07
sp|B8EI29|UBIG_METSB Ubiquinone biosynthesis O-methyltransferase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=ubiG PE=3 SV=1 36 123 7.0E-07
sp|Q2SN12|UBIE_HAHCH Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Hahella chejuensis (strain KCTC 2396) GN=ubiE PE=3 SV=1 38 147 1.0E-06
sp|Q16D32|UBIG_ROSDO Ubiquinone biosynthesis O-methyltransferase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=ubiG PE=3 SV=1 36 144 1.0E-06
sp|Q8KF69|MENG_CHLTE Demethylmenaquinone methyltransferase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=menG PE=3 SV=1 43 139 1.0E-06
sp|Q482G8|UBIG_COLP3 Ubiquinone biosynthesis O-methyltransferase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=ubiG PE=3 SV=1 42 141 2.0E-06
sp|Q8EBQ3|RLMD_SHEON 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Shewanella oneidensis (strain MR-1) GN=rlmD PE=3 SV=1 39 101 2.0E-06
sp|Q1GCH8|UBIG_RUEST Ubiquinone biosynthesis O-methyltransferase OS=Ruegeria sp. (strain TM1040) GN=ubiG PE=3 SV=1 42 144 2.0E-06
sp|Q5YPB0|MENG_NOCFA Demethylmenaquinone methyltransferase OS=Nocardia farcinica (strain IFM 10152) GN=menG PE=3 SV=1 38 142 2.0E-06
sp|Q9RX93|TAM_DEIRA Trans-aconitate 2-methyltransferase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=tam PE=3 SV=1 34 145 2.0E-06
sp|P46326|YXBB_BACSU Uncharacterized protein YxbB OS=Bacillus subtilis (strain 168) GN=yxbB PE=3 SV=1 44 164 2.0E-06
sp|B4EBC4|UBIE_BURCJ Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=ubiE PE=3 SV=1 37 162 3.0E-06
sp|B1JYJ6|UBIE_BURCC Ubiquinone/menaquinone biosynthesis C-methyltransferase UbiE OS=Burkholderia cenocepacia (strain MC0-3) GN=ubiE PE=3 SV=1 37 162 3.0E-06
sp|Q6FFY1|UBIG_ACIAD Ubiquinone biosynthesis O-methyltransferase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=ubiG PE=3 SV=1 43 141 3.0E-06
sp|A4Y759|UBIG_SHEPC Ubiquinone biosynthesis O-methyltransferase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=ubiG PE=3 SV=1 43 133 4.0E-06
sp|A1RJD1|UBIG_SHESW Ubiquinone biosynthesis O-methyltransferase OS=Shewanella sp. (strain W3-18-1) GN=ubiG PE=3 SV=1 43 133 4.0E-06
sp|P67064|MENG_TROWT Demethylmenaquinone methyltransferase OS=Tropheryma whipplei (strain Twist) GN=menG PE=3 SV=1 24 147 4.0E-06
sp|P67065|MENG_TROW8 Demethylmenaquinone methyltransferase OS=Tropheryma whipplei (strain TW08/27) GN=menG PE=3 SV=1 24 147 4.0E-06
sp|B2HRQ2|MENG_MYCMM Demethylmenaquinone methyltransferase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=menG PE=3 SV=1 24 194 4.0E-06
sp|D2T333|BIOC_ERWP6 Malonyl-[acyl-carrier protein] O-methyltransferase OS=Erwinia pyrifoliae (strain DSM 12163 / CIP 106111 / Ep16/96) GN=bioC PE=3 SV=1 34 142 4.0E-06
sp|C6CWS7|BIOC_PAESJ Malonyl-[acyl-carrier protein] O-methyltransferase OS=Paenibacillus sp. (strain JDR-2) GN=bioC PE=3 SV=1 43 142 4.0E-06
sp|Q820B5|UBIG_COXBU Ubiquinone biosynthesis O-methyltransferase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=ubiG PE=3 SV=1 44 124 4.0E-06
sp|A9NBI0|UBIG_COXBR Ubiquinone biosynthesis O-methyltransferase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=ubiG PE=3 SV=1 44 124 4.0E-06
sp|B6J1W2|UBIG_COXB2 Ubiquinone biosynthesis O-methyltransferase OS=Coxiella burnetii (strain CbuG_Q212) GN=ubiG PE=3 SV=1 44 124 4.0E-06
sp|A0KU76|RLMD_SHESA 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Shewanella sp. (strain ANA-3) GN=rlmD PE=3 SV=1 28 101 5.0E-06
sp|B6J5Y2|UBIG_COXB1 Ubiquinone biosynthesis O-methyltransferase OS=Coxiella burnetii (strain CbuK_Q154) GN=ubiG PE=3 SV=1 44 124 5.0E-06
sp|A9KGL7|UBIG_COXBN Ubiquinone biosynthesis O-methyltransferase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=ubiG PE=3 SV=1 44 124 6.0E-06
sp|Q0HXI0|RLMD_SHESR 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD OS=Shewanella sp. (strain MR-7) GN=rlmD PE=3 SV=2 39 101 6.0E-06
sp|P9WFR3|MENG_MYCTU Demethylmenaquinone methyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=menG PE=1 SV=1 24 190 8.0E-06
sp|P9WFR2|MENG_MYCTO Demethylmenaquinone methyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=menG PE=3 SV=1 24 190 8.0E-06
sp|A5TZT8|MENG_MYCTA Demethylmenaquinone methyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=menG PE=3 SV=1 24 190 8.0E-06
sp|C1AKN8|MENG_MYCBT Demethylmenaquinone methyltransferase OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=menG PE=3 SV=1 24 190 8.0E-06
sp|A1KG35|MENG_MYCBP Demethylmenaquinone methyltransferase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=menG PE=3 SV=1 24 190 8.0E-06
sp|P0A639|MENG_MYCBO Demethylmenaquinone methyltransferase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=menG PE=3 SV=1 24 190 8.0E-06
sp|A9L2Y4|UBIG_SHEB9 Ubiquinone biosynthesis O-methyltransferase OS=Shewanella baltica (strain OS195) GN=ubiG PE=3 SV=1 43 133 8.0E-06
sp|A6WNN7|UBIG_SHEB8 Ubiquinone biosynthesis O-methyltransferase OS=Shewanella baltica (strain OS185) GN=ubiG PE=3 SV=1 43 133 8.0E-06
sp|A3D499|UBIG_SHEB5 Ubiquinone biosynthesis O-methyltransferase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=ubiG PE=3 SV=1 43 133 8.0E-06
sp|B8EA88|UBIG_SHEB2 Ubiquinone biosynthesis O-methyltransferase OS=Shewanella baltica (strain OS223) GN=ubiG PE=3 SV=1 43 133 8.0E-06
sp|A1SE26|MENG_NOCSJ Demethylmenaquinone methyltransferase OS=Nocardioides sp. (strain BAA-499 / JS614) GN=menG PE=3 SV=1 39 193 8.0E-06
sp|C5C0T0|MENG_BEUC1 Demethylmenaquinone methyltransferase OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=menG PE=3 SV=1 39 191 8.0E-06
sp|Q2SE61|UBIG_HAHCH Ubiquinone biosynthesis O-methyltransferase OS=Hahella chejuensis (strain KCTC 2396) GN=ubiG PE=3 SV=1 40 136 8.0E-06
sp|P64842|Y1440_MYCBO Uncharacterized protein Mb1440c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1440c PE=3 SV=1 38 141 9.0E-06
sp|P9WLY7|Y1405_MYCTU Uncharacterized protein Rv1405c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1405c PE=1 SV=1 38 141 9.0E-06
sp|P9WLY6|Y1405_MYCTO Uncharacterized protein MT1449 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1449 PE=3 SV=1 38 141 9.0E-06
sp|Q0AME1|UBIG_MARMM Ubiquinone biosynthesis O-methyltransferase OS=Maricaulis maris (strain MCS10) GN=ubiG PE=3 SV=1 41 144 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0016741 transferase activity, transferring one-carbon groups No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2906
MMAASHPSVYAADHSAPVLRTHSWRTAANSCAYLVPHVRPAMKILDVGCGPGSITLDLARLVPDGHVTGLENVPE
PLDAARALATQQAVSNVTFSMGDIHALPFDNDSFDVVHAHQVLQHVADPVAALCEMRRVARSDGGIVACRESAAM
TWFPASEPLEAWRRLTMAIAAGKGGNPHPGARIHVWAQQAGFSRDSIVKSTDSWCFSSDAERQYWGGSMAQRARA
SRFVNMALDDGYSTPHELDHIAAGWDAFCQDADAWFGLLHGQILCRK*
Coding >OphauB2|2906
ATGATGGCCGCCTCGCACCCTTCTGTCTATGCCGCGGACCACTCGGCCCCTGTGCTGCGCACCCACAGCTGGCGC
ACTGCCGCCAACTCTTGCGCCTATCTGGTTCCTCATGTCAGGCCCGCCATGAAGATTCTCGACGTGGGCTGCGGC
CCGGGCTCCATCACGCTTGATCTTGCACGCCTTGTGCCAGACGGGCACGTCACGGGCCTTGAAAACGTGCCCGAG
CCGCTCGATGCCGCGCGCGCCCTCGCCACCCAGCAGGCCGTCTCCAACGTGACCTTCTCCATGGGCGACATCCAT
GCGCTGCCCTTTGACAATGACAGCTTCGACGTGGTCCATGCCCATCAGGTCCTCCAGCACGTCGCCGACCCCGTG
GCCGCCCTGTGCGAGATGCGCCGCGTCGCCCGCTCTGACGGCGGCATTGTGGCCTGTCGTGAGTCGGCTGCCATG
ACTTGGTTTCCTGCCTCGGAGCCCCTGGAGGCCTGGCGCCGCCTGACCATGGCCATTGCTGCAGGCAAAGGCGGC
AACCCACACCCAGGCGCACGCATCCACGTCTGGGCCCAACAGGCTGGCTTCTCCAGAGACAGCATCGTCAAAAGC
ACCGACTCGTGGTGCTTTAGTAGCGATGCTGAGCGCCAGTACTGGGGCGGATCCATGGCCCAGAGAGCCAGGGCG
TCGCGCTTTGTCAACATGGCCCTAGACGACGGTTACTCGACGCCCCACGAGCTGGACCACATTGCCGCCGGCTGG
GATGCTTTTTGTCAAGACGCCGATGCATGGTTTGGTCTGTTGCACGGCCAGATTCTCTGCCGCAAGTAA
Transcript >OphauB2|2906
ATGATGGCCGCCTCGCACCCTTCTGTCTATGCCGCGGACCACTCGGCCCCTGTGCTGCGCACCCACAGCTGGCGC
ACTGCCGCCAACTCTTGCGCCTATCTGGTTCCTCATGTCAGGCCCGCCATGAAGATTCTCGACGTGGGCTGCGGC
CCGGGCTCCATCACGCTTGATCTTGCACGCCTTGTGCCAGACGGGCACGTCACGGGCCTTGAAAACGTGCCCGAG
CCGCTCGATGCCGCGCGCGCCCTCGCCACCCAGCAGGCCGTCTCCAACGTGACCTTCTCCATGGGCGACATCCAT
GCGCTGCCCTTTGACAATGACAGCTTCGACGTGGTCCATGCCCATCAGGTCCTCCAGCACGTCGCCGACCCCGTG
GCCGCCCTGTGCGAGATGCGCCGCGTCGCCCGCTCTGACGGCGGCATTGTGGCCTGTCGTGAGTCGGCTGCCATG
ACTTGGTTTCCTGCCTCGGAGCCCCTGGAGGCCTGGCGCCGCCTGACCATGGCCATTGCTGCAGGCAAAGGCGGC
AACCCACACCCAGGCGCACGCATCCACGTCTGGGCCCAACAGGCTGGCTTCTCCAGAGACAGCATCGTCAAAAGC
ACCGACTCGTGGTGCTTTAGTAGCGATGCTGAGCGCCAGTACTGGGGCGGATCCATGGCCCAGAGAGCCAGGGCG
TCGCGCTTTGTCAACATGGCCCTAGACGACGGTTACTCGACGCCCCACGAGCTGGACCACATTGCCGCCGGCTGG
GATGCTTTTTGTCAAGACGCCGATGCATGGTTTGGTCTGTTGCACGGCCAGATTCTCTGCCGCAAGTAA
Gene >OphauB2|2906
ATGATGGCCGCCTCGCACCCTTCTGTCTATGCCGCGGACCACTCGGCCCCTGTGCTGCGCACCCACAGCTGGCGC
ACTGCCGCCAACTCTTGCGCCTATCTGGTTCCTCATGTCAGGCCCGCCATGAAGATTCTCGACGTGGGCTGCGGC
CCGGGCTCCATCACGCTTGATCTTGCACGCCTTGTGCCAGACGGGCACGTCACGGGCCTTGAAAACGTGCCCGAG
CCGCTCGATGCCGCGCGCGCCCTCGCCACCCAGCAGGCCGTCTCCAACGTGACCTTCTCCATGGGCGACATCCAT
GCGCTGCCCTTTGACAATGACAGCTTCGACGTGGTCCATGCCCATCAGGTCCTCCAGCACGTCGCCGACCCCGTG
GCCGCCCTGTGCGAGATGCGCCGCGTCGCCCGCTCTGACGGCGGCATTGTGGCCTGTCGTGAGTCGGCTGCCATG
ACTTGGTTTCCTGCCTCGGAGCCCCTGGAGGCCTGGCGCCGCCTGACCATGGCCATTGCTGCAGGCAAAGGCGGC
AACCCACACCCAGGCGCACGCATCCACGTCTGGGCCCAACAGGCTGGCTTCTCCAGAGACAGCATCGTCAAAAGC
ACCGACTCGTGGTGCTTTAGTAGCGATGCTGAGCGCCAGTACTGGGGCGGATCCATGGCCCAGAGAGCCAGGGCG
TCGCGCTTTGTCAACATGGCCCTAGACGACGGTTACTCGACGCCCCACGAGCTGGACCACATTGCCGCCGGCTGG
GATGCTTTTTGTCAAGACGCCGATGCATGGTTTGGTCTGTTGCACGGCCAGATTCTCTGCCGCAAGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail