Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2903
Gene name
LocationContig_2:141..1046
Strand-
Gene length (bp)905
Transcript length (bp)834
Coding sequence length (bp)834
Protein length (aa) 278

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14040 DNase_NucA_NucB Deoxyribonuclease NucA/NucB 2.4E-14 21 134

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2903
MFISLAAATFFLVGSAAAKGVVYDCEKTPQICLNTCWAIKCQKNSETLHGGGQKDKSASSKYGDANRRKWGYGSK
PCDRQWKWTTPDNKAATSPDEYPYASSKEGGESNFQRVVALRCVPTTEQSSQGGKLKGLGTSKNSETWNTKWINI
SKLSQDWCGPKPSCKNDGHQFVSGGSNGPFTLASNPKKVRDIGSYSADGNSAWVESREVSEDVVPEKNEDDDGDD
AEDPEDVEEHKDVKDVDAAANGVHINISHEKNETNVEVHVVNGGGVEVVFES*
Coding >OphauB2|2903
ATGTTCATTTCACTTGCTGCTGCAACATTCTTTCTCGTCGGCTCTGCTGCGGCCAAGGGAGTTGTCTACGACTGC
GAAAAAACCCCGCAAATCTGTCTCAACACCTGCTGGGCCATCAAGTGCCAAAAGAACTCAGAGACGCTGCACGGC
GGCGGCCAAAAAGACAAGTCTGCGTCTTCAAAATACGGCGACGCCAACCGCAGAAAATGGGGCTATGGCTCCAAG
CCTTGCGACAGGCAATGGAAGTGGACAACTCCTGATAACAAGGCAGCGACTTCGCCCGACGAGTATCCCTATGCG
TCATCTAAAGAGGGCGGCGAGTCCAATTTCCAAAGAGTTGTTGCTCTTCGTTGTGTGCCCACGACAGAGCAGAGT
TCTCAGGGAGGCAAGCTCAAGGGCCTCGGTACCAGCAAGAACTCGGAGACATGGAACACCAAGTGGATTAACATT
AGCAAGTTATCCCAAGATTGGTGTGGCCCCAAGCCTAGCTGCAAGAACGATGGCCATCAGTTCGTCTCTGGTGGC
TCGAATGGCCCCTTCACTCTAGCTTCGAATCCCAAGAAAGTTCGTGACATTGGCTCCTACTCTGCAGATGGCAAC
AGTGCTTGGGTAGAGAGCCGTGAGGTTTCCGAGGACGTTGTTCCAGAGAAAAATGAGGATGATGATGGCGATGAT
GCTGAAGACCCCGAAGATGTTGAAGAGCACAAAGATGTTAAAGATGTCGATGCTGCTGCTAATGGCGTGCATATC
AATATTTCTCACGAGAAGAATGAGACTAATGTTGAAGTTCATGTTGTCAATGGCGGCGGCGTCGAGGTTGTGTTT
GAGTCTTGA
Transcript >OphauB2|2903
ATGTTCATTTCACTTGCTGCTGCAACATTCTTTCTCGTCGGCTCTGCTGCGGCCAAGGGAGTTGTCTACGACTGC
GAAAAAACCCCGCAAATCTGTCTCAACACCTGCTGGGCCATCAAGTGCCAAAAGAACTCAGAGACGCTGCACGGC
GGCGGCCAAAAAGACAAGTCTGCGTCTTCAAAATACGGCGACGCCAACCGCAGAAAATGGGGCTATGGCTCCAAG
CCTTGCGACAGGCAATGGAAGTGGACAACTCCTGATAACAAGGCAGCGACTTCGCCCGACGAGTATCCCTATGCG
TCATCTAAAGAGGGCGGCGAGTCCAATTTCCAAAGAGTTGTTGCTCTTCGTTGTGTGCCCACGACAGAGCAGAGT
TCTCAGGGAGGCAAGCTCAAGGGCCTCGGTACCAGCAAGAACTCGGAGACATGGAACACCAAGTGGATTAACATT
AGCAAGTTATCCCAAGATTGGTGTGGCCCCAAGCCTAGCTGCAAGAACGATGGCCATCAGTTCGTCTCTGGTGGC
TCGAATGGCCCCTTCACTCTAGCTTCGAATCCCAAGAAAGTTCGTGACATTGGCTCCTACTCTGCAGATGGCAAC
AGTGCTTGGGTAGAGAGCCGTGAGGTTTCCGAGGACGTTGTTCCAGAGAAAAATGAGGATGATGATGGCGATGAT
GCTGAAGACCCCGAAGATGTTGAAGAGCACAAAGATGTTAAAGATGTCGATGCTGCTGCTAATGGCGTGCATATC
AATATTTCTCACGAGAAGAATGAGACTAATGTTGAAGTTCATGTTGTCAATGGCGGCGGCGTCGAGGTTGTGTTT
GAGTCTTGA
Gene >OphauB2|2903
ATGTTCATTTCACTTGCTGCTGCAACATTCTTTCTCGTCGGCTCTGCTGCGGCCAAGGGAGTTGTCTACGACTGC
GAAAAAACCCCGCAAATCTGTCTCAACACCTGCTGGGCCATCAAGTGCCAAAAGAACTCAGAGACGCTGCACGGC
GGCGGCCAAAAAGACAAGTCTGCGTCTTCAAAATACGGCGACGCCAACCGCAGAAAATGGGGCTATGGCTCCAAG
CCTTGCGACAGGCAATGGAAGTGGACAACTCCTGATAACAAGGCAGCGACTTCGCCCGACGAGTATCCCTATGCG
TCATCTAAAGAGGGCGGCGAGTCCAATTTCCAAAGAGTTGTTGCTCTTCGTTGTGTGCCCACGACAGAGCAGAGT
TGTGAGGCTATCCGCCTTTACCATCTGAAGATCTTTATTTGGCCGTGGAAAGCTAATGTCCCTGAATCACAGCTC
AGGGAGGCAAGCTCAAGGGCCTCGGTACCAGCAAGAACTCGGAGACATGGAACACCAAGTGGATTAACATTAGCA
AGTTATCCCAAGATTGGTGTGGCCCCAAGCCTAGCTGCAAGAACGATGGCCATCAGTTCGTCTCTGGTGGCTCGA
ATGGCCCCTTCACTCTAGCTTCGAATCCCAAGAAAGTTCGTGACATTGGCTCCTACTCTGCAGATGGCAACAGTG
CTTGGGTAGAGAGCCGTGAGGTTTCCGAGGACGTTGTTCCAGAGAAAAATGAGGATGATGATGGCGATGATGCTG
AAGACCCCGAAGATGTTGAAGAGCACAAAGATGTTAAAGATGTCGATGCTGCTGCTAATGGCGTGCATATCAATA
TTTCTCACGAGAAGAATGAGACTAATGTTGAAGTTCATGTTGTCAATGGCGGCGGCGTCGAGGTTGTGTTTGAGT
CTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail