Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2901
Gene name
LocationContig_199:27512..31526
Strand-
Gene length (bp)4014
Transcript length (bp)3933
Coding sequence length (bp)3933
Protein length (aa) 1311

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03770 IPK Inositol polyphosphate kinase 1.2E-55 1053 1272

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74561|YCZ8_SCHPO Uncharacterized inositol polyphosphate kinase C970.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC970.08 PE=1 SV=1 1049 1280 1.0E-58
sp|Q12494|KCS1_YEAST Inositol hexakisphosphate kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KCS1 PE=1 SV=1 1050 1307 1.0E-52
sp|Q9UHH9|IP6K2_HUMAN Inositol hexakisphosphate kinase 2 OS=Homo sapiens GN=IP6K2 PE=1 SV=2 1053 1268 5.0E-32
sp|Q9ESM0|IP6K1_RAT Inositol hexakisphosphate kinase 1 OS=Rattus norvegicus GN=Ip6k1 PE=2 SV=1 1047 1282 5.0E-32
sp|Q80V72|IP6K2_MOUSE Inositol hexakisphosphate kinase 2 OS=Mus musculus GN=Ip6k2 PE=2 SV=2 1053 1268 1.0E-31
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74561|YCZ8_SCHPO Uncharacterized inositol polyphosphate kinase C970.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC970.08 PE=1 SV=1 1049 1280 1.0E-58
sp|Q12494|KCS1_YEAST Inositol hexakisphosphate kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KCS1 PE=1 SV=1 1050 1307 1.0E-52
sp|Q9UHH9|IP6K2_HUMAN Inositol hexakisphosphate kinase 2 OS=Homo sapiens GN=IP6K2 PE=1 SV=2 1053 1268 5.0E-32
sp|Q9ESM0|IP6K1_RAT Inositol hexakisphosphate kinase 1 OS=Rattus norvegicus GN=Ip6k1 PE=2 SV=1 1047 1282 5.0E-32
sp|Q80V72|IP6K2_MOUSE Inositol hexakisphosphate kinase 2 OS=Mus musculus GN=Ip6k2 PE=2 SV=2 1053 1268 1.0E-31
sp|Q6PD10|IP6K1_MOUSE Inositol hexakisphosphate kinase 1 OS=Mus musculus GN=Ip6k1 PE=2 SV=1 1047 1282 1.0E-31
sp|Q95221|IP6K2_RABIT Inositol hexakisphosphate kinase 2 OS=Oryctolagus cuniculus GN=IP6K2 PE=2 SV=1 1041 1268 1.0E-31
sp|Q9R0U1|IP6K2_RAT Inositol hexakisphosphate kinase 2 OS=Rattus norvegicus GN=Ip6k2 PE=2 SV=2 1053 1268 3.0E-31
sp|Q92551|IP6K1_HUMAN Inositol hexakisphosphate kinase 1 OS=Homo sapiens GN=IP6K1 PE=1 SV=3 1047 1282 3.0E-31
sp|Q8BWD2|IP6K3_MOUSE Inositol hexakisphosphate kinase 3 OS=Mus musculus GN=Ip6k3 PE=2 SV=1 1048 1276 4.0E-31
sp|Q96PC2|IP6K3_HUMAN Inositol hexakisphosphate kinase 3 OS=Homo sapiens GN=IP6K3 PE=1 SV=2 1014 1191 1.0E-28
sp|O74561|YCZ8_SCHPO Uncharacterized inositol polyphosphate kinase C970.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC970.08 PE=1 SV=1 619 847 3.0E-25
sp|Q12494|KCS1_YEAST Inositol hexakisphosphate kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KCS1 PE=1 SV=1 612 823 8.0E-22
sp|Q8NFU5|IPMK_HUMAN Inositol polyphosphate multikinase OS=Homo sapiens GN=IPMK PE=1 SV=1 1053 1193 3.0E-14
sp|Q7TT16|IPMK_MOUSE Inositol polyphosphate multikinase OS=Mus musculus GN=Ipmk PE=1 SV=1 1053 1193 1.0E-13
sp|Q99NI4|IPMK_RAT Inositol polyphosphate multikinase OS=Rattus norvegicus GN=Ipmk PE=2 SV=1 1053 1193 2.0E-13
sp|P07250|IPMK_YEAST Inositol polyphosphate multikinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ARG82 PE=1 SV=1 1053 1191 4.0E-09
sp|Q9FLT2|IPMKB_ARATH Inositol polyphosphate multikinase beta OS=Arabidopsis thaliana GN=IPK2b PE=1 SV=1 1054 1198 8.0E-07
sp|Q9US14|YK64_SCHPO Uncharacterized inositol polyphosphate kinase C607.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC607.04 PE=3 SV=1 1054 1189 1.0E-06
sp|Q95221|IP6K2_RABIT Inositol hexakisphosphate kinase 2 OS=Oryctolagus cuniculus GN=IP6K2 PE=2 SV=1 619 686 2.0E-06
sp|Q9R0U1|IP6K2_RAT Inositol hexakisphosphate kinase 2 OS=Rattus norvegicus GN=Ip6k2 PE=2 SV=2 619 686 3.0E-06
sp|Q9UHH9|IP6K2_HUMAN Inositol hexakisphosphate kinase 2 OS=Homo sapiens GN=IP6K2 PE=1 SV=2 619 686 4.0E-06
sp|Q9ESM0|IP6K1_RAT Inositol hexakisphosphate kinase 1 OS=Rattus norvegicus GN=Ip6k1 PE=2 SV=1 619 680 5.0E-06
sp|Q92551|IP6K1_HUMAN Inositol hexakisphosphate kinase 1 OS=Homo sapiens GN=IP6K1 PE=1 SV=3 619 680 6.0E-06
sp|Q6PD10|IP6K1_MOUSE Inositol hexakisphosphate kinase 1 OS=Mus musculus GN=Ip6k1 PE=2 SV=1 619 680 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0032958 inositol phosphate biosynthetic process Yes
GO:0016301 kinase activity Yes
GO:0006796 phosphate-containing compound metabolic process No
GO:0019751 polyol metabolic process No
GO:0006066 alcohol metabolic process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0008150 biological_process No
GO:0090407 organophosphate biosynthetic process No
GO:0003674 molecular_function No
GO:0006793 phosphorus metabolic process No
GO:0043647 inositol phosphate metabolic process No
GO:0046173 polyol biosynthetic process No
GO:0046165 alcohol biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:1901617 organic hydroxy compound biosynthetic process No
GO:0019637 organophosphate metabolic process No
GO:0003824 catalytic activity No
GO:0044283 small molecule biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0044281 small molecule metabolic process No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0009058 biosynthetic process No
GO:0016740 transferase activity No
GO:1901615 organic hydroxy compound metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4717
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5236
Ophiocordyceps australis map64 (Brazil) OphauB2|2901 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|03755
Ophiocordyceps camponoti-rufipedis Ophun1|3298
Ophiocordyceps kimflemingae Ophio5|376
Ophiocordyceps subramaniannii Hirsu2|9927

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2901
MSSPHLDSENASLLPPLSRDCAGLCPTRLASTHIANPQHDNTSNNCSTGRDKTKACQTTANGHGTPSIMAPANGT
ALPPRARDKTSYGGANCDAAIKSRGSSAGPSLLTQALASARGIASLSTLPAPHHDANPQSKAQSSVSHGQLLGDG
QCAHVSSLTTGPPHFDSMAASTTIPALSTPPSLLDTSLAAIKPPFVQPLAANARGTPTGKCDFLQRAKTQIATSL
ESSPSALDALQMRAISSPSTSPSDSTSAGMPHSTSKAVPSTAPESWCLGASHDPLSPCHARLGEHPLTTSPEKNE
KIWSIGSGDCNEEDGLVEKSVAEAMAGVEPNTRSRKASYSLRFFKEGLPSDEKGRNKDSKATSRDKLPSMLEEDD
GKTAQVSADSIRSPSLMSGASASDADKELSNRPPVEPHAQVLSLSLLQRCHSVAVHQSPQPPARQESICHVVDVA
KEPNSPASESTARGRRSSSEAEREADAEADADESGEEKISSAVFMPHQEMPDVRLSPAKPMGSCHGQKAHRLPPS
QAHPWLVKADEPEPENNDHEVRDKDEPCFEVCPVRTREAASRQGDVLVESPDKSQVRSELEVKRAMVPKLPPFVT
PYEGHVHEQQSHARKPLDAIDLIPYKHQVGGHTTLWRFSRRAVCKQLNNRENEFYETIERYHRDLLPFLPRYIGV
LNVTFHKQPRRRSTVKKDDALAERRKIEEQVKKHHRTNGCSTGASEATGQELTYTPTRVISQSLANASVQVPTVT
FDDNKHILPRNLLQPTPPLDYFRRRSIPTCQTYQASNSGNAKCRRPQLDERPNSWGATTINKRLRNEVFNDAFLK
QPVEVQKHQRLHQRSIPRPVFQRLLRPAASDPSLLLETQRDDKADKERGAQQKAPVPSSSGEATSIVGSETGLLP
EGSKPKDASIKDITGTSAPEPEIIKATPVANKKKRRFSAGGLRRKPEDVREPRGSLKYFEQADDAKYKSEDQASP
SPMAKTTVAFNGNASQSSDTNACQLHSVASGVADVQECFTLLSDPSDAMVEFRKIPRPMNPKEAKKEAKTRRDRV
EYFLLMEDLTAGMKRPCMMDLKMGTRQYGVDASPKKQKSQQEKCRTTTSAELGVRICGLQVWNVETQSYEFQDKY
FGRQVKAGQEFQDALQRFLYNGVELESVLRHIPTILKKLIQLEQIICGLRGYRFYAASLLMFYDGETRSDEGGYE
TAYDSMTDVATDAEDTTRLRRKKIGEIDFKMADFANSLTPLDKLDDRPCPPSHPDEPDGGFLKGLRSLRHYFLQI
QRSVRDQLGVSSGRLSSSAGEPIDYEFDDEDKISV*
Coding >OphauB2|2901
ATGTCCAGTCCGCATCTCGACTCTGAAAATGCCTCACTCCTTCCGCCACTGAGCCGCGACTGTGCCGGTCTGTGC
CCAACAAGACTGGCATCCACTCACATCGCCAACCCGCAGCACGACAACACAAGCAATAACTGCTCTACGGGCCGC
GACAAGACAAAGGCCTGCCAAACCACCGCTAACGGGCATGGCACACCGTCCATCATGGCTCCCGCCAACGGCACT
GCGCTGCCCCCACGTGCTCGGGACAAGACATCCTATGGAGGCGCCAATTGCGACGCCGCTATAAAGTCTCGCGGA
TCCTCAGCCGGTCCCTCGCTGCTGACGCAAGCTCTGGCCTCTGCCCGGGGCATCGCATCACTGTCGACTTTGCCT
GCACCTCATCACGACGCTAATCCACAGTCCAAGGCTCAGTCGTCTGTCAGTCATGGTCAGCTCCTCGGTGACGGC
CAGTGCGCCCACGTGTCATCTTTGACCACGGGTCCGCCACATTTTGACAGCATGGCAGCTTCAACAACAATACCT
GCTCTCTCGACTCCCCCTTCCTTGCTTGACACCAGCCTGGCTGCCATCAAGCCGCCGTTTGTCCAGCCACTTGCG
GCCAATGCCAGAGGCACGCCGACTGGCAAGTGTGACTTTCTTCAACGCGCCAAGACCCAAATTGCTACATCTCTC
GAGTCGAGTCCATCTGCCTTGGATGCTCTCCAGATGCGCGCTATTTCTTCTCCCTCTACTAGTCCCAGTGATTCG
ACTAGTGCCGGCATGCCGCACTCTACTTCCAAGGCTGTGCCGTCTACTGCTCCCGAATCATGGTGTCTTGGTGCC
TCCCATGACCCACTCTCGCCCTGCCACGCTCGACTGGGCGAGCACCCCTTGACTACAAGCCCCGAAAAGAATGAA
AAGATTTGGTCTATTGGCTCCGGCGACTGCAACGAGGAAGATGGCCTCGTAGAAAAGTCGGTCGCCGAGGCCATG
GCTGGCGTCGAGCCCAATACACGCAGTCGCAAGGCCAGCTATAGCTTACGCTTCTTCAAGGAAGGCCTCCCTTCA
GACGAAAAGGGTCGCAACAAGGATTCCAAGGCTACTTCGCGAGATAAGCTGCCGTCCATGTTGGAAGAAGATGAC
GGCAAGACGGCCCAGGTTTCTGCCGACAGTATACGTTCCCCTTCGTTGATGAGCGGAGCTTCCGCTTCCGATGCT
GATAAGGAACTTTCGAATCGGCCCCCAGTCGAGCCTCATGCGCAGGTACTCTCCCTTTCCCTGCTCCAACGCTGC
CATTCAGTTGCTGTGCACCAAAGTCCTCAGCCGCCTGCGAGGCAAGAGAGCATTTGCCATGTTGTTGACGTGGCA
AAAGAGCCCAATTCGCCCGCCTCGGAGTCGACAGCACGTGGGCGTCGCAGCAGCTCCGAGGCAGAGAGAGAGGCA
GATGCTGAGGCGGATGCTGACGAATCTGGTGAGGAAAAAATTTCGTCGGCTGTGTTTATGCCTCACCAAGAAATG
CCTGATGTGCGACTGAGTCCGGCCAAGCCTATGGGCTCTTGCCATGGCCAAAAAGCACACAGACTGCCTCCAAGT
CAGGCTCACCCCTGGTTGGTCAAGGCCGATGAGCCCGAGCCTGAGAACAATGACCACGAGGTTCGTGACAAAGAT
GAGCCTTGCTTTGAAGTTTGCCCCGTTCGCACCCGTGAGGCTGCTTCTCGCCAAGGCGACGTTCTGGTCGAGTCA
CCAGACAAAAGCCAAGTTAGAAGCGAATTGGAAGTCAAGCGTGCCATGGTCCCCAAGCTGCCTCCGTTTGTGACG
CCATACGAAGGCCATGTGCATGAGCAACAGTCCCACGCCCGGAAACCCCTCGATGCTATTGATTTGATTCCGTAC
AAACATCAAGTTGGCGGCCATACAACCCTCTGGCGTTTCTCCCGCCGAGCCGTTTGTAAGCAGCTCAACAATAGG
GAGAATGAGTTTTACGAGACAATCGAAAGATATCATCGTGACTTGCTTCCGTTTTTGCCCCGATATATTGGCGTC
TTGAACGTCACTTTTCACAAGCAACCCAGACGAAGGAGTACTGTCAAAAAGGACGACGCCCTTGCTGAGCGAAGA
AAGATTGAGGAACAAGTCAAGAAACACCACAGGACAAATGGCTGCAGTACTGGGGCGTCCGAGGCTACCGGCCAG
GAGCTGACGTATACGCCTACAAGAGTCATCAGCCAGTCCTTGGCTAATGCCAGCGTCCAGGTCCCGACTGTCACT
TTTGATGATAACAAGCATATACTGCCTCGTAACCTATTGCAACCGACGCCCCCTCTGGATTATTTTCGACGCCGG
AGCATTCCCACCTGCCAAACTTACCAAGCCTCAAACAGTGGCAATGCAAAATGTAGACGGCCCCAGTTGGACGAG
AGACCGAACAGCTGGGGAGCTACAACCATCAACAAGCGCTTGCGCAACGAGGTGTTTAACGATGCTTTCTTGAAG
CAGCCTGTCGAGGTGCAGAAACATCAGCGCCTGCATCAGCGGTCTATTCCTCGCCCAGTGTTCCAGAGGCTATTA
CGGCCAGCGGCTTCAGATCCCAGCCTACTTTTAGAAACTCAGAGGGATGACAAGGCCGACAAGGAGCGAGGCGCT
CAGCAAAAAGCTCCTGTGCCTTCATCATCTGGTGAAGCTACGAGCATCGTGGGCTCTGAAACAGGTTTGCTACCA
GAAGGGTCAAAACCCAAGGATGCCTCTATCAAGGACATTACTGGGACTAGTGCTCCAGAGCCGGAAATTATAAAG
GCTACTCCAGTAGCCAACAAGAAGAAGCGGCGGTTTTCTGCTGGTGGGCTTCGTCGAAAACCTGAAGATGTGCGA
GAGCCTCGAGGTAGTTTAAAATACTTTGAACAAGCCGACGATGCCAAGTATAAATCAGAAGATCAGGCGTCTCCG
TCTCCAATGGCTAAGACTACGGTTGCTTTCAATGGCAACGCGAGCCAGTCGTCAGATACTAATGCGTGCCAATTG
CACAGTGTCGCATCTGGGGTCGCAGATGTACAGGAATGCTTCACTCTATTATCGGATCCCTCTGATGCCATGGTT
GAGTTTAGAAAGATTCCTCGGCCCATGAATCCCAAGGAGGCCAAGAAAGAGGCCAAGACGCGTCGAGACCGTGTC
GAGTACTTCCTGCTCATGGAGGATCTGACGGCGGGTATGAAGCGGCCATGCATGATGGATCTCAAGATGGGCACT
CGCCAGTACGGTGTTGACGCCAGTCCGAAGAAGCAAAAATCGCAACAGGAAAAATGTAGGACGACTACGTCTGCG
GAGTTGGGCGTTCGCATTTGCGGGCTTCAGGTGTGGAATGTTGAAACGCAAAGCTACGAATTCCAGGACAAGTAT
TTTGGACGGCAGGTCAAGGCTGGCCAAGAGTTCCAAGATGCGCTACAAAGATTTCTCTATAATGGTGTTGAGCTG
GAAAGCGTGTTGCGGCACATCCCCACGATCCTGAAGAAGCTGATCCAGCTGGAGCAAATCATTTGCGGCCTGCGC
GGCTATCGCTTCTACGCAGCCAGTCTGCTAATGTTTTACGACGGCGAGACGAGGTCCGACGAAGGTGGATACGAA
ACGGCTTATGACTCTATGACGGACGTGGCAACAGACGCTGAGGATACGACGAGGCTGCGGAGGAAGAAGATTGGC
GAGATTGATTTCAAAATGGCAGACTTTGCCAACAGCCTGACACCGCTGGACAAATTGGACGATAGACCGTGTCCC
CCTAGCCACCCAGATGAGCCAGACGGGGGCTTCTTGAAGGGACTGCGAAGCTTGCGCCACTACTTTTTGCAGATT
CAACGAAGTGTACGGGACCAGCTTGGTGTGAGTTCGGGCAGACTATCTTCCTCTGCAGGAGAACCCATTGACTAT
GAGTTTGACGACGAAGATAAGATTAGTGTTTGA
Transcript >OphauB2|2901
ATGTCCAGTCCGCATCTCGACTCTGAAAATGCCTCACTCCTTCCGCCACTGAGCCGCGACTGTGCCGGTCTGTGC
CCAACAAGACTGGCATCCACTCACATCGCCAACCCGCAGCACGACAACACAAGCAATAACTGCTCTACGGGCCGC
GACAAGACAAAGGCCTGCCAAACCACCGCTAACGGGCATGGCACACCGTCCATCATGGCTCCCGCCAACGGCACT
GCGCTGCCCCCACGTGCTCGGGACAAGACATCCTATGGAGGCGCCAATTGCGACGCCGCTATAAAGTCTCGCGGA
TCCTCAGCCGGTCCCTCGCTGCTGACGCAAGCTCTGGCCTCTGCCCGGGGCATCGCATCACTGTCGACTTTGCCT
GCACCTCATCACGACGCTAATCCACAGTCCAAGGCTCAGTCGTCTGTCAGTCATGGTCAGCTCCTCGGTGACGGC
CAGTGCGCCCACGTGTCATCTTTGACCACGGGTCCGCCACATTTTGACAGCATGGCAGCTTCAACAACAATACCT
GCTCTCTCGACTCCCCCTTCCTTGCTTGACACCAGCCTGGCTGCCATCAAGCCGCCGTTTGTCCAGCCACTTGCG
GCCAATGCCAGAGGCACGCCGACTGGCAAGTGTGACTTTCTTCAACGCGCCAAGACCCAAATTGCTACATCTCTC
GAGTCGAGTCCATCTGCCTTGGATGCTCTCCAGATGCGCGCTATTTCTTCTCCCTCTACTAGTCCCAGTGATTCG
ACTAGTGCCGGCATGCCGCACTCTACTTCCAAGGCTGTGCCGTCTACTGCTCCCGAATCATGGTGTCTTGGTGCC
TCCCATGACCCACTCTCGCCCTGCCACGCTCGACTGGGCGAGCACCCCTTGACTACAAGCCCCGAAAAGAATGAA
AAGATTTGGTCTATTGGCTCCGGCGACTGCAACGAGGAAGATGGCCTCGTAGAAAAGTCGGTCGCCGAGGCCATG
GCTGGCGTCGAGCCCAATACACGCAGTCGCAAGGCCAGCTATAGCTTACGCTTCTTCAAGGAAGGCCTCCCTTCA
GACGAAAAGGGTCGCAACAAGGATTCCAAGGCTACTTCGCGAGATAAGCTGCCGTCCATGTTGGAAGAAGATGAC
GGCAAGACGGCCCAGGTTTCTGCCGACAGTATACGTTCCCCTTCGTTGATGAGCGGAGCTTCCGCTTCCGATGCT
GATAAGGAACTTTCGAATCGGCCCCCAGTCGAGCCTCATGCGCAGGTACTCTCCCTTTCCCTGCTCCAACGCTGC
CATTCAGTTGCTGTGCACCAAAGTCCTCAGCCGCCTGCGAGGCAAGAGAGCATTTGCCATGTTGTTGACGTGGCA
AAAGAGCCCAATTCGCCCGCCTCGGAGTCGACAGCACGTGGGCGTCGCAGCAGCTCCGAGGCAGAGAGAGAGGCA
GATGCTGAGGCGGATGCTGACGAATCTGGTGAGGAAAAAATTTCGTCGGCTGTGTTTATGCCTCACCAAGAAATG
CCTGATGTGCGACTGAGTCCGGCCAAGCCTATGGGCTCTTGCCATGGCCAAAAAGCACACAGACTGCCTCCAAGT
CAGGCTCACCCCTGGTTGGTCAAGGCCGATGAGCCCGAGCCTGAGAACAATGACCACGAGGTTCGTGACAAAGAT
GAGCCTTGCTTTGAAGTTTGCCCCGTTCGCACCCGTGAGGCTGCTTCTCGCCAAGGCGACGTTCTGGTCGAGTCA
CCAGACAAAAGCCAAGTTAGAAGCGAATTGGAAGTCAAGCGTGCCATGGTCCCCAAGCTGCCTCCGTTTGTGACG
CCATACGAAGGCCATGTGCATGAGCAACAGTCCCACGCCCGGAAACCCCTCGATGCTATTGATTTGATTCCGTAC
AAACATCAAGTTGGCGGCCATACAACCCTCTGGCGTTTCTCCCGCCGAGCCGTTTGTAAGCAGCTCAACAATAGG
GAGAATGAGTTTTACGAGACAATCGAAAGATATCATCGTGACTTGCTTCCGTTTTTGCCCCGATATATTGGCGTC
TTGAACGTCACTTTTCACAAGCAACCCAGACGAAGGAGTACTGTCAAAAAGGACGACGCCCTTGCTGAGCGAAGA
AAGATTGAGGAACAAGTCAAGAAACACCACAGGACAAATGGCTGCAGTACTGGGGCGTCCGAGGCTACCGGCCAG
GAGCTGACGTATACGCCTACAAGAGTCATCAGCCAGTCCTTGGCTAATGCCAGCGTCCAGGTCCCGACTGTCACT
TTTGATGATAACAAGCATATACTGCCTCGTAACCTATTGCAACCGACGCCCCCTCTGGATTATTTTCGACGCCGG
AGCATTCCCACCTGCCAAACTTACCAAGCCTCAAACAGTGGCAATGCAAAATGTAGACGGCCCCAGTTGGACGAG
AGACCGAACAGCTGGGGAGCTACAACCATCAACAAGCGCTTGCGCAACGAGGTGTTTAACGATGCTTTCTTGAAG
CAGCCTGTCGAGGTGCAGAAACATCAGCGCCTGCATCAGCGGTCTATTCCTCGCCCAGTGTTCCAGAGGCTATTA
CGGCCAGCGGCTTCAGATCCCAGCCTACTTTTAGAAACTCAGAGGGATGACAAGGCCGACAAGGAGCGAGGCGCT
CAGCAAAAAGCTCCTGTGCCTTCATCATCTGGTGAAGCTACGAGCATCGTGGGCTCTGAAACAGGTTTGCTACCA
GAAGGGTCAAAACCCAAGGATGCCTCTATCAAGGACATTACTGGGACTAGTGCTCCAGAGCCGGAAATTATAAAG
GCTACTCCAGTAGCCAACAAGAAGAAGCGGCGGTTTTCTGCTGGTGGGCTTCGTCGAAAACCTGAAGATGTGCGA
GAGCCTCGAGGTAGTTTAAAATACTTTGAACAAGCCGACGATGCCAAGTATAAATCAGAAGATCAGGCGTCTCCG
TCTCCAATGGCTAAGACTACGGTTGCTTTCAATGGCAACGCGAGCCAGTCGTCAGATACTAATGCGTGCCAATTG
CACAGTGTCGCATCTGGGGTCGCAGATGTACAGGAATGCTTCACTCTATTATCGGATCCCTCTGATGCCATGGTT
GAGTTTAGAAAGATTCCTCGGCCCATGAATCCCAAGGAGGCCAAGAAAGAGGCCAAGACGCGTCGAGACCGTGTC
GAGTACTTCCTGCTCATGGAGGATCTGACGGCGGGTATGAAGCGGCCATGCATGATGGATCTCAAGATGGGCACT
CGCCAGTACGGTGTTGACGCCAGTCCGAAGAAGCAAAAATCGCAACAGGAAAAATGTAGGACGACTACGTCTGCG
GAGTTGGGCGTTCGCATTTGCGGGCTTCAGGTGTGGAATGTTGAAACGCAAAGCTACGAATTCCAGGACAAGTAT
TTTGGACGGCAGGTCAAGGCTGGCCAAGAGTTCCAAGATGCGCTACAAAGATTTCTCTATAATGGTGTTGAGCTG
GAAAGCGTGTTGCGGCACATCCCCACGATCCTGAAGAAGCTGATCCAGCTGGAGCAAATCATTTGCGGCCTGCGC
GGCTATCGCTTCTACGCAGCCAGTCTGCTAATGTTTTACGACGGCGAGACGAGGTCCGACGAAGGTGGATACGAA
ACGGCTTATGACTCTATGACGGACGTGGCAACAGACGCTGAGGATACGACGAGGCTGCGGAGGAAGAAGATTGGC
GAGATTGATTTCAAAATGGCAGACTTTGCCAACAGCCTGACACCGCTGGACAAATTGGACGATAGACCGTGTCCC
CCTAGCCACCCAGATGAGCCAGACGGGGGCTTCTTGAAGGGACTGCGAAGCTTGCGCCACTACTTTTTGCAGATT
CAACGAAGTGTACGGGACCAGCTTGGTGTGAGTTCGGGCAGACTATCTTCCTCTGCAGGAGAACCCATTGACTAT
GAGTTTGACGACGAAGATAAGATTAGTGTTTGA
Gene >OphauB2|2901
ATGTCCAGTCCGCATCTCGACTCTGAAAATGCCTCACTCCTTCCGCCACTGAGCCGCGACTGTGCCGGTCTGTGC
CCAACAAGACTGGCATCCACTCACATCGCCAACCCGCAGCACGACAACACAAGCAATAACTGCTCTACGGGCCGC
GACAAGACAAAGGCCTGCCAAACCACCGCTAACGGGCATGGCACACCGTCCATCATGGCTCCCGCCAACGGCACT
GCGCTGCCCCCACGTGCTCGGGACAAGACATCCTATGGAGGCGCCAATTGCGACGCCGCTATAAAGTCTCGCGGA
TCCTCAGCCGGTCCCTCGCTGCTGACGCAAGCTCTGGCCTCTGCCCGGGGCATCGCATCACTGTCGACTTTGCCT
GCACCTCATCACGACGCTAATCCACAGTCCAAGGCTCAGTCGTCTGTCAGTCATGGTCAGCTCCTCGGTGACGGC
CAGTGCGCCCACGTGTCATCTTTGACCACGGGTCCGCCACATTTTGACAGCATGGCAGCTTCAACAACAATACCT
GCTCTCTCGACTCCCCCTTCCTTGCTTGACACCAGCCTGGCTGCCATCAAGCCGCCGTTTGTCCAGCCACTTGCG
GCCAATGCCAGAGGCACGCCGACTGGCAAGTGTGACTTTCTTCAACGCGCCAAGACCCAAATTGCTACATCTCTC
GAGTCGAGTCCATCTGCCTTGGATGCTCTCCAGATGCGCGCTATTTCTTCTCCCTCTACTAGTCCCAGTGATTCG
ACTAGTGCCGGCATGCCGCACTCTACTTCCAAGGCTGTGCCGTCTACTGCTCCCGAATCATGGTGTCTTGGTGCC
TCCCATGACCCACTCTCGCCCTGCCACGCTCGACTGGGCGAGCACCCCTTGACTACAAGCCCCGAAAAGAATGAA
AAGATTTGGTCTATTGGCTCCGGCGACTGCAACGAGGAAGATGGCCTCGTAGAAAAGTCGGTCGCCGAGGCCATG
GCTGGCGTCGAGCCCAATACACGCAGTCGCAAGGCCAGCTATAGCTTACGCTTCTTCAAGGAAGGCCTCCCTTCA
GACGAAAAGGGTCGCAACAAGGATTCCAAGGCTACTTCGCGAGATAAGCTGCCGTCCATGTTGGAAGAAGATGAC
GGCAAGACGGCCCAGGTTTCTGCCGACAGTATACGTTCCCCTTCGTTGATGAGCGGAGCTTCCGCTTCCGATGCT
GATAAGGAACTTTCGAATCGGCCCCCAGTCGAGCCTCATGCGCAGGTACTCTCCCTTTCCCTGCTCCAACGCTGC
CATTCAGTTGCTGTGCACCAAAGTCCTCAGCCGCCTGCGAGGCAAGAGAGCATTTGCCATGTTGTTGACGTGGCA
AAAGAGCCCAATTCGCCCGCCTCGGAGTCGACAGCACGTGGGCGTCGCAGCAGCTCCGAGGCAGAGAGAGAGGCA
GATGCTGAGGCGGATGCTGACGAATCTGGTGAGGAAAAAATTTCGTCGGCTGTGTTTATGCCTCACCAAGAAATG
CCTGATGTGCGACTGAGTCCGGCCAAGCCTATGGGCTCTTGCCATGGCCAAAAAGCACACAGACTGCCTCCAAGT
CAGGCTCACCCCTGGTTGGTCAAGGCCGATGAGCCCGAGCCTGAGAACAATGACCACGAGGTTCGTGACAAAGAT
GAGCCTTGCTTTGAAGTTTGCCCCGTTCGCACCCGTGAGGCTGCTTCTCGCCAAGGCGACGTTCTGGTCGAGTCA
CCAGACAAAAGCCAAGTTAGAAGCGAATTGGAAGTCAAGCGTGCCATGGTCCCCAAGCTGCCTCCGTTTGTGACG
CCATACGAAGGCCATGTGCATGAGCAACAGTCCCACGCCCGGAAACCCCTCGATGCTATTGATTTGATTCCGTAC
AAACATCAAGTTGGCGGCCATACAACCCTCTGGCGTTTCTCCCGCCGAGCCGTTTGTAAGCAGCTCAACAATAGG
GAGAATGAGTTTTACGAGACAATCGAAAGATATCATCGTGACTTGCTTCCGTTTTTGCCCCGGTATGTCTCCCGG
TTCACGGCAGGATTCCATCCGCCTCGATTCCACTCCGTGTCTAGAGCTGTGCTAACATGGGATTAAAGATATATT
GGCGTCTTGAACGTCACTTTTCACAAGCAACCCAGACGAAGGAGTACTGTCAAAAAGGACGACGCCCTTGCTGAG
CGAAGAAAGATTGAGGAACAAGTCAAGAAACACCACAGGACAAATGGCTGCAGTACTGGGGCGTCCGAGGCTACC
GGCCAGGAGCTGACGTATACGCCTACAAGAGTCATCAGCCAGTCCTTGGCTAATGCCAGCGTCCAGGTCCCGACT
GTCACTTTTGATGATAACAAGCATATACTGCCTCGTAACCTATTGCAACCGACGCCCCCTCTGGATTATTTTCGA
CGCCGGAGCATTCCCACCTGCCAAACTTACCAAGCCTCAAACAGTGGCAATGCAAAATGTAGACGGCCCCAGTTG
GACGAGAGACCGAACAGCTGGGGAGCTACAACCATCAACAAGCGCTTGCGCAACGAGGTGTTTAACGATGCTTTC
TTGAAGCAGCCTGTCGAGGTGCAGAAACATCAGCGCCTGCATCAGCGGTCTATTCCTCGCCCAGTGTTCCAGAGG
CTATTACGGCCAGCGGCTTCAGATCCCAGCCTACTTTTAGAAACTCAGAGGGATGACAAGGCCGACAAGGAGCGA
GGCGCTCAGCAAAAAGCTCCTGTGCCTTCATCATCTGGTGAAGCTACGAGCATCGTGGGCTCTGAAACAGGTTTG
CTACCAGAAGGGTCAAAACCCAAGGATGCCTCTATCAAGGACATTACTGGGACTAGTGCTCCAGAGCCGGAAATT
ATAAAGGCTACTCCAGTAGCCAACAAGAAGAAGCGGCGGTTTTCTGCTGGTGGGCTTCGTCGAAAACCTGAAGAT
GTGCGAGAGCCTCGAGGTAGTTTAAAATACTTTGAACAAGCCGACGATGCCAAGTATAAATCAGAAGATCAGGCG
TCTCCGTCTCCAATGGCTAAGACTACGGTTGCTTTCAATGGCAACGCGAGCCAGTCGTCAGATACTAATGCGTGC
CAATTGCACAGTGTCGCATCTGGGGTCGCAGATGTACAGGAATGCTTCACTCTATTATCGGATCCCTCTGATGCC
ATGGTTGAGTTTAGAAAGATTCCTCGGCCCATGAATCCCAAGGAGGCCAAGAAAGAGGCCAAGACGCGTCGAGAC
CGTGTCGAGTACTTCCTGCTCATGGAGGATCTGACGGCGGGTATGAAGCGGCCATGCATGATGGATCTCAAGATG
GGCACTCGCCAGTACGGTGTTGACGCCAGTCCGAAGAAGCAAAAATCGCAACAGGAAAAATGTAGGACGACTACG
TCTGCGGAGTTGGGCGTTCGCATTTGCGGGCTTCAGGTGTGGAATGTTGAAACGCAAAGCTACGAATTCCAGGAC
AAGTATTTTGGACGGCAGGTCAAGGCTGGCCAAGAGTTCCAAGATGCGCTACAAAGATTTCTCTATAATGGTGTT
GAGCTGGAAAGCGTGTTGCGGCACATCCCCACGATCCTGAAGAAGCTGATCCAGCTGGAGCAAATCATTTGCGGC
CTGCGCGGCTATCGCTTCTACGCAGCCAGTCTGCTAATGTTTTACGACGGCGAGACGAGGTCCGACGAAGGTGGA
TACGAAACGGCTTATGACTCTATGACGGACGTGGCAACAGACGCTGAGGATACGACGAGGCTGCGGAGGAAGAAG
ATTGGCGAGATTGATTTCAAAATGGCAGACTTTGCCAACAGCCTGACACCGCTGGACAAATTGGACGATAGACCG
TGTCCCCCTAGCCACCCAGATGAGCCAGACGGGGGCTTCTTGAAGGGACTGCGAAGCTTGCGCCACTACTTTTTG
CAGATTCAACGAAGTGTACGGGACCAGCTTGGTGTGAGTTCGGGCAGACTATCTTCCTCTGCAGGAGAACCCATT
GACTATGAGTTTGACGACGAAGATAAGATTAGTGTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail