Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2893
Gene name
LocationContig_199:15095..15905
Strand+
Gene length (bp)810
Transcript length (bp)810
Coding sequence length (bp)810
Protein length (aa) 270

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13373 Dsc3_C DSC E3 ubiquitin ligase complex subunit 3, C-terminal domain 6.2E-30 139 262
PF10302 Dsc3_N DSC E3 ubiquitin ligase complex subunit 3, ubiquitin-like domain 8.3E-21 9 102

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9HE10|DSC3_SCHPO DSC E3 ubiquitin ligase complex subunit 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dsc3 PE=1 SV=1 2 266 4.0E-23
sp|Q12015|YO223_YEAST Transmembrane protein YOR223W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOR223W PE=1 SV=1 4 265 2.0E-14

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 216 238 22
2 245 267 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2893
MTSAPPPLHLTVRFSTSLADIHLDIPAPQRTSILALKLLLRTRLSSRARLRFIHQGRILADSAALSTVNPTPPPP
QPPLHDVKGKGAALPLARVYLNCAIGPDLSPDQLAAEEAAAQKPPCPDGPAEHARRTATAQRPRGFDRLRNAGFS
HSEISTLRTQFASVYADRFPPDAPPSPDSQRRLEDAWIDNNAADLPSATPGSPADDAASMSSVLDVLIRGMMIGF
FFPLASLTWLLRLTIWSDKWRIFVGSGVALSIIVGTIMGLSGNR*
Coding >OphauB2|2893
ATGACCTCTGCTCCGCCTCCTCTCCATCTCACCGTCCGCTTCTCCACCTCGCTCGCCGATATCCATCTCGACATT
CCCGCCCCCCAGCGCACCTCCATCCTCGCCCTCAAGCTCCTCCTGCGCACCCGTCTCTCCTCCCGCGCCCGCCTC
CGCTTCATCCACCAAGGCCGCATCCTCGCCGACTCTGCCGCCCTCAGCACCGTCAATCCAACTCCTCCCCCGCCC
CAGCCCCCTCTCCATGATGTCAAGGGCAAAGGTGCCGCCCTGCCCCTGGCCCGCGTCTACCTAAACTGCGCTATT
GGCCCTGATCTTTCGCCCGACCAACTCGCTGCCGAAGAGGCTGCTGCCCAGAAGCCGCCCTGCCCCGATGGCCCA
GCTGAACATGCCAGGCGAACAGCCACGGCACAGCGCCCCCGTGGCTTCGACCGCCTTCGCAATGCCGGCTTCTCC
CACTCAGAAATCTCAACCCTGCGCACCCAGTTTGCCTCGGTCTATGCCGACCGCTTTCCCCCTGATGCTCCGCCT
TCCCCCGACTCCCAGCGTCGTCTGGAGGACGCCTGGATCGATAACAATGCCGCCGACTTGCCATCTGCAACCCCA
GGCTCCCCTGCCGACGATGCAGCCTCCATGTCCTCGGTCCTCGATGTCTTGATTCGTGGCATGATGATTGGCTTC
TTTTTCCCTCTGGCTAGCCTTACCTGGCTTCTGCGCCTGACCATTTGGTCTGACAAATGGAGGATTTTTGTCGGC
TCGGGTGTCGCATTAAGCATCATTGTCGGAACCATCATGGGTCTTTCTGGTAATCGCTGA
Transcript >OphauB2|2893
ATGACCTCTGCTCCGCCTCCTCTCCATCTCACCGTCCGCTTCTCCACCTCGCTCGCCGATATCCATCTCGACATT
CCCGCCCCCCAGCGCACCTCCATCCTCGCCCTCAAGCTCCTCCTGCGCACCCGTCTCTCCTCCCGCGCCCGCCTC
CGCTTCATCCACCAAGGCCGCATCCTCGCCGACTCTGCCGCCCTCAGCACCGTCAATCCAACTCCTCCCCCGCCC
CAGCCCCCTCTCCATGATGTCAAGGGCAAAGGTGCCGCCCTGCCCCTGGCCCGCGTCTACCTAAACTGCGCTATT
GGCCCTGATCTTTCGCCCGACCAACTCGCTGCCGAAGAGGCTGCTGCCCAGAAGCCGCCCTGCCCCGATGGCCCA
GCTGAACATGCCAGGCGAACAGCCACGGCACAGCGCCCCCGTGGCTTCGACCGCCTTCGCAATGCCGGCTTCTCC
CACTCAGAAATCTCAACCCTGCGCACCCAGTTTGCCTCGGTCTATGCCGACCGCTTTCCCCCTGATGCTCCGCCT
TCCCCCGACTCCCAGCGTCGTCTGGAGGACGCCTGGATCGATAACAATGCCGCCGACTTGCCATCTGCAACCCCA
GGCTCCCCTGCCGACGATGCAGCCTCCATGTCCTCGGTCCTCGATGTCTTGATTCGTGGCATGATGATTGGCTTC
TTTTTCCCTCTGGCTAGCCTTACCTGGCTTCTGCGCCTGACCATTTGGTCTGACAAATGGAGGATTTTTGTCGGC
TCGGGTGTCGCATTAAGCATCATTGTCGGAACCATCATGGGTCTTTCTGGTAATCGCTGA
Gene >OphauB2|2893
ATGACCTCTGCTCCGCCTCCTCTCCATCTCACCGTCCGCTTCTCCACCTCGCTCGCCGATATCCATCTCGACATT
CCCGCCCCCCAGCGCACCTCCATCCTCGCCCTCAAGCTCCTCCTGCGCACCCGTCTCTCCTCCCGCGCCCGCCTC
CGCTTCATCCACCAAGGCCGCATCCTCGCCGACTCTGCCGCCCTCAGCACCGTCAATCCAACTCCTCCCCCGCCC
CAGCCCCCTCTCCATGATGTCAAGGGCAAAGGTGCCGCCCTGCCCCTGGCCCGCGTCTACCTAAACTGCGCTATT
GGCCCTGATCTTTCGCCCGACCAACTCGCTGCCGAAGAGGCTGCTGCCCAGAAGCCGCCCTGCCCCGATGGCCCA
GCTGAACATGCCAGGCGAACAGCCACGGCACAGCGCCCCCGTGGCTTCGACCGCCTTCGCAATGCCGGCTTCTCC
CACTCAGAAATCTCAACCCTGCGCACCCAGTTTGCCTCGGTCTATGCCGACCGCTTTCCCCCTGATGCTCCGCCT
TCCCCCGACTCCCAGCGTCGTCTGGAGGACGCCTGGATCGATAACAATGCCGCCGACTTGCCATCTGCAACCCCA
GGCTCCCCTGCCGACGATGCAGCCTCCATGTCCTCGGTCCTCGATGTCTTGATTCGTGGCATGATGATTGGCTTC
TTTTTCCCTCTGGCTAGCCTTACCTGGCTTCTGCGCCTGACCATTTGGTCTGACAAATGGAGGATTTTTGTCGGC
TCGGGTGTCGCATTAAGCATCATTGTCGGAACCATCATGGGTCTTTCTGGTAATCGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail