Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2892
Gene name
LocationContig_199:12660..14703
Strand-
Gene length (bp)2043
Transcript length (bp)1965
Coding sequence length (bp)1965
Protein length (aa) 655

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09779 Ima1_N Ima1 N-terminal domain 4.6E-23 9 129

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O13681|IINMP_SCHPO Integral inner nuclear membrane protein ima1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=IMA1 PE=4 SV=2 9 330 2.0E-13

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

Domain # Start End Length
1 248 270 22
2 285 304 19
3 541 563 22
4 600 622 22
5 629 648 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2892
MSFRASGQLACFYCGRQSSCAAAPGRMQSFECSHCDATNYLDAEGSIMDPPVATELEGAPKRYVAAQASGVGDSV
FCAKCLDNQRLLTSCLAQYSNSRDDFVLDGEYYSFRKQQEQRYPQVCDACAVKVQQSILKAGYTAKTDHLRRMMD
MSRGKRIVTTAPGRLDCLSALGAATWQAGFLLQMLWHAKSVVLAMLAHDANAIALPVAQLVAHLPAAHRLASWSI
AAGFASAWWNPHFVQVNRGFTRHLLGLAQWYCFQGLIVFFRLASRKMLTINGGHSKSRDACISAHLGIAVTMMLM
YVYAQRSIRVDTSMLFSCSAASSMPRPSPPTAKENDNETLSRHLAQTLESPSPPAKLSQAQRPHHATPQTPIHRH
TRAPEPDEMDWSPIVPPHRAFCSQPRATGESPGLKKNPFRYPVPPAPFNVANSPWRPLEAQQPQQNIAQARPSFQ
FGRPHSHVGQPPMSSHPSVEFRPPSFFAQQSQDDDSSLAELLGRSFTISQPHAQDEGQETEVDDGVQQVSARIRG
IPSPPPKKKQKLLCGLFSYQSILLMNMLAIWMLAMLWTRYAHLVHPGLMALAGIISLRDAGDRSRDAQWHLLEPT
TMQYFFSALGVGELAALCWVGNEALKGDAAVANYGAAILAAMLAVRMLRQRGHG*
Coding >OphauB2|2892
ATGAGCTTCCGCGCGTCGGGGCAGCTGGCCTGCTTTTACTGCGGGCGACAGTCGTCATGCGCAGCAGCACCAGGG
CGCATGCAGAGCTTTGAGTGCAGCCACTGCGATGCGACCAACTACCTCGACGCCGAGGGCTCCATTATGGATCCG
CCTGTTGCGACGGAGCTCGAAGGCGCGCCCAAGCGATATGTTGCTGCTCAGGCGTCTGGCGTGGGCGACAGCGTC
TTTTGCGCAAAGTGCCTGGACAACCAGCGGCTGCTTACCAGCTGTCTGGCGCAGTACTCCAACAGCCGCGACGAC
TTTGTGCTTGATGGCGAATACTACAGCTTCCGCAAACAACAGGAGCAGCGCTATCCCCAAGTATGCGACGCCTGT
GCCGTCAAGGTGCAGCAGAGCATCCTCAAGGCCGGCTACACGGCCAAGACGGACCACTTGCGCCGCATGATGGAC
ATGAGCCGCGGCAAACGCATCGTGACCACGGCACCCGGACGCCTCGACTGCCTCAGTGCCCTCGGCGCAGCCACG
TGGCAAGCCGGCTTCTTGCTCCAGATGCTGTGGCATGCCAAGTCTGTCGTGCTGGCCATGCTGGCCCACGACGCC
AATGCCATTGCCCTGCCTGTCGCCCAGCTCGTGGCCCATCTGCCTGCCGCCCACCGCCTTGCTAGCTGGAGCATT
GCTGCCGGCTTTGCCTCTGCCTGGTGGAATCCCCATTTTGTTCAGGTCAACCGCGGCTTCACCAGGCATCTCCTG
GGACTGGCCCAATGGTACTGCTTCCAGGGCCTCATTGTCTTCTTCCGCCTTGCCTCGCGCAAGATGCTCACCATC
AATGGGGGCCACAGCAAATCCAGAGACGCCTGCATCAGTGCTCATTTGGGCATAGCAGTCACCATGATGCTGATG
TATGTCTACGCCCAAAGGTCGATTCGCGTCGACACCTCGATGCTCTTTTCCTGCAGCGCTGCCTCGTCGATGCCT
CGGCCCTCTCCCCCCACCGCCAAGGAGAATGACAACGAGACCTTGTCCCGCCATCTTGCCCAAACCCTAGAGTCG
CCCAGTCCACCCGCCAAGCTCTCCCAGGCCCAACGCCCTCATCATGCCACCCCCCAGACCCCCATTCATCGCCAC
ACTCGGGCCCCGGAACCCGACGAGATGGACTGGTCTCCCATTGTGCCGCCACACCGTGCTTTTTGCAGCCAGCCC
CGTGCGACAGGAGAGTCGCCCGGCCTCAAGAAGAATCCTTTTCGATACCCTGTGCCGCCCGCTCCCTTCAACGTG
GCCAATAGCCCCTGGAGGCCCTTGGAAGCACAGCAGCCACAGCAAAACATTGCCCAGGCAAGACCCAGCTTCCAA
TTCGGCAGACCCCACAGCCATGTTGGGCAGCCGCCCATGTCGTCGCATCCAAGCGTGGAGTTTAGGCCACCCTCC
TTTTTTGCCCAGCAAAGCCAAGACGACGATAGCTCGCTGGCCGAGCTGCTGGGCCGCAGCTTCACCATCAGCCAG
CCCCATGCCCAGGACGAGGGCCAAGAGACCGAGGTGGACGACGGAGTCCAGCAAGTGTCTGCGCGAATACGAGGC
ATTCCCTCCCCTCCCCCCAAGAAGAAGCAGAAGCTGTTGTGTGGCCTTTTCTCATACCAGTCGATACTGCTCATG
AATATGCTGGCCATTTGGATGCTTGCTATGCTTTGGACAAGGTACGCGCACCTTGTGCACCCGGGGCTCATGGCC
CTTGCGGGCATCATATCCCTGCGCGATGCGGGAGATCGAAGCCGAGACGCACAATGGCATCTACTTGAGCCGACT
ACGATGCAGTATTTTTTTTCAGCCCTGGGTGTGGGCGAGTTGGCCGCCTTGTGCTGGGTGGGCAATGAAGCACTA
AAGGGAGACGCAGCGGTTGCTAATTACGGAGCGGCCATTCTGGCGGCCATGCTGGCAGTGCGCATGCTGCGGCAG
AGGGGCCATGGATGA
Transcript >OphauB2|2892
ATGAGCTTCCGCGCGTCGGGGCAGCTGGCCTGCTTTTACTGCGGGCGACAGTCGTCATGCGCAGCAGCACCAGGG
CGCATGCAGAGCTTTGAGTGCAGCCACTGCGATGCGACCAACTACCTCGACGCCGAGGGCTCCATTATGGATCCG
CCTGTTGCGACGGAGCTCGAAGGCGCGCCCAAGCGATATGTTGCTGCTCAGGCGTCTGGCGTGGGCGACAGCGTC
TTTTGCGCAAAGTGCCTGGACAACCAGCGGCTGCTTACCAGCTGTCTGGCGCAGTACTCCAACAGCCGCGACGAC
TTTGTGCTTGATGGCGAATACTACAGCTTCCGCAAACAACAGGAGCAGCGCTATCCCCAAGTATGCGACGCCTGT
GCCGTCAAGGTGCAGCAGAGCATCCTCAAGGCCGGCTACACGGCCAAGACGGACCACTTGCGCCGCATGATGGAC
ATGAGCCGCGGCAAACGCATCGTGACCACGGCACCCGGACGCCTCGACTGCCTCAGTGCCCTCGGCGCAGCCACG
TGGCAAGCCGGCTTCTTGCTCCAGATGCTGTGGCATGCCAAGTCTGTCGTGCTGGCCATGCTGGCCCACGACGCC
AATGCCATTGCCCTGCCTGTCGCCCAGCTCGTGGCCCATCTGCCTGCCGCCCACCGCCTTGCTAGCTGGAGCATT
GCTGCCGGCTTTGCCTCTGCCTGGTGGAATCCCCATTTTGTTCAGGTCAACCGCGGCTTCACCAGGCATCTCCTG
GGACTGGCCCAATGGTACTGCTTCCAGGGCCTCATTGTCTTCTTCCGCCTTGCCTCGCGCAAGATGCTCACCATC
AATGGGGGCCACAGCAAATCCAGAGACGCCTGCATCAGTGCTCATTTGGGCATAGCAGTCACCATGATGCTGATG
TATGTCTACGCCCAAAGGTCGATTCGCGTCGACACCTCGATGCTCTTTTCCTGCAGCGCTGCCTCGTCGATGCCT
CGGCCCTCTCCCCCCACCGCCAAGGAGAATGACAACGAGACCTTGTCCCGCCATCTTGCCCAAACCCTAGAGTCG
CCCAGTCCACCCGCCAAGCTCTCCCAGGCCCAACGCCCTCATCATGCCACCCCCCAGACCCCCATTCATCGCCAC
ACTCGGGCCCCGGAACCCGACGAGATGGACTGGTCTCCCATTGTGCCGCCACACCGTGCTTTTTGCAGCCAGCCC
CGTGCGACAGGAGAGTCGCCCGGCCTCAAGAAGAATCCTTTTCGATACCCTGTGCCGCCCGCTCCCTTCAACGTG
GCCAATAGCCCCTGGAGGCCCTTGGAAGCACAGCAGCCACAGCAAAACATTGCCCAGGCAAGACCCAGCTTCCAA
TTCGGCAGACCCCACAGCCATGTTGGGCAGCCGCCCATGTCGTCGCATCCAAGCGTGGAGTTTAGGCCACCCTCC
TTTTTTGCCCAGCAAAGCCAAGACGACGATAGCTCGCTGGCCGAGCTGCTGGGCCGCAGCTTCACCATCAGCCAG
CCCCATGCCCAGGACGAGGGCCAAGAGACCGAGGTGGACGACGGAGTCCAGCAAGTGTCTGCGCGAATACGAGGC
ATTCCCTCCCCTCCCCCCAAGAAGAAGCAGAAGCTGTTGTGTGGCCTTTTCTCATACCAGTCGATACTGCTCATG
AATATGCTGGCCATTTGGATGCTTGCTATGCTTTGGACAAGGTACGCGCACCTTGTGCACCCGGGGCTCATGGCC
CTTGCGGGCATCATATCCCTGCGCGATGCGGGAGATCGAAGCCGAGACGCACAATGGCATCTACTTGAGCCGACT
ACGATGCAGTATTTTTTTTCAGCCCTGGGTGTGGGCGAGTTGGCCGCCTTGTGCTGGGTGGGCAATGAAGCACTA
AAGGGAGACGCAGCGGTTGCTAATTACGGAGCGGCCATTCTGGCGGCCATGCTGGCAGTGCGCATGCTGCGGCAG
AGGGGCCATGGATGA
Gene >OphauB2|2892
ATGAGCTTCCGCGCGTCGGGGCAGCTGGCCTGCTTTTACTGCGGGCGACAGTCGTCATGCGCAGCAGCACCAGGG
CGCATGCAGAGCTTTGAGTGCAGCCACTGCGATGCGACCAACTACCTCGACGCCGAGGGCTCCATTATGGATCCG
CCTGTTGCGACGGAGCTCGAAGGCGCGCCCAAGCGATATGTTGCTGCTCAGGCGTCTGGCGTGGGCGACAGCGTC
TTTTGCGCAAAGTGCCTGGACAACCAGCGGCTGCTTACCAGCTGTCTGGCGCAGTACTCCAACAGCCGCGACGAC
TTTGTGCTTGATGGCGAATACTACAGCTTCCGCAAACAACAGGAGCAGCGCTATCCCCAAGTATGCGACGCCTGT
GCCGTCAAGGTGCAGCAGAGCATCCTCAAGGCCGGCTACACGGCCAAGACGGACCACTTGCGCCGCATGATGGAC
ATGAGCCGCGGCAAACGCATCGTGACCACGGCACCCGGACGCCTCGACTGCCTCAGTGCCCTCGGCGCAGCCACG
TGGCAAGCCGGCTTCTTGCTCCAGATGCTGTGGCATGCCAAGTCTGTCGTGCTGGCCATGCTGGCCCACGACGCC
AATGCCATTGCCCTGCCTGTCGCCCAGCTCGTGGCCCATCTGCCTGCCGCCCACCGCCTTGCTAGCTGGAGCATT
GCTGCCGGCTTTGCCTCTGCCTGGTGGAATCCCCATTTTGTTCAGGTCAACCGCGGCTTCACCAGGCATCTCCTG
GGACTGGCCCAATGGTACTGCTTCCAGGGCCTCATTGTCTTCTTCCGCCTTGCCTCGCGCAAGATGCTCACCATC
AATGGGGGCCACAGCAAATCCAGAGACGCCTGCATCAGTGCTCATTTGGGCATAGCAGTCACCATGATGCTGGTA
AGTGCCACGCCCCTCCACGCCCCTCCACGCCCCTCCATGCCCGGCCAATGCTAAAGCAGAAGCGCCATGCAAAAG
ATGTATGTCTACGCCCAAAGGTCGATTCGCGTCGACACCTCGATGCTCTTTTCCTGCAGCGCTGCCTCGTCGATG
CCTCGGCCCTCTCCCCCCACCGCCAAGGAGAATGACAACGAGACCTTGTCCCGCCATCTTGCCCAAACCCTAGAG
TCGCCCAGTCCACCCGCCAAGCTCTCCCAGGCCCAACGCCCTCATCATGCCACCCCCCAGACCCCCATTCATCGC
CACACTCGGGCCCCGGAACCCGACGAGATGGACTGGTCTCCCATTGTGCCGCCACACCGTGCTTTTTGCAGCCAG
CCCCGTGCGACAGGAGAGTCGCCCGGCCTCAAGAAGAATCCTTTTCGATACCCTGTGCCGCCCGCTCCCTTCAAC
GTGGCCAATAGCCCCTGGAGGCCCTTGGAAGCACAGCAGCCACAGCAAAACATTGCCCAGGCAAGACCCAGCTTC
CAATTCGGCAGACCCCACAGCCATGTTGGGCAGCCGCCCATGTCGTCGCATCCAAGCGTGGAGTTTAGGCCACCC
TCCTTTTTTGCCCAGCAAAGCCAAGACGACGATAGCTCGCTGGCCGAGCTGCTGGGCCGCAGCTTCACCATCAGC
CAGCCCCATGCCCAGGACGAGGGCCAAGAGACCGAGGTGGACGACGGAGTCCAGCAAGTGTCTGCGCGAATACGA
GGCATTCCCTCCCCTCCCCCCAAGAAGAAGCAGAAGCTGTTGTGTGGCCTTTTCTCATACCAGTCGATACTGCTC
ATGAATATGCTGGCCATTTGGATGCTTGCTATGCTTTGGACAAGGTACGCGCACCTTGTGCACCCGGGGCTCATG
GCCCTTGCGGGCATCATATCCCTGCGCGATGCGGGAGATCGAAGCCGAGACGCACAATGGCATCTACTTGAGCCG
ACTACGATGCAGTATTTTTTTTCAGCCCTGGGTGTGGGCGAGTTGGCCGCCTTGTGCTGGGTGGGCAATGAAGCA
CTAAAGGGAGACGCAGCGGTTGCTAATTACGGAGCGGCCATTCTGGCGGCCATGCTGGCAGTGCGCATGCTGCGG
CAGAGGGGCCATGGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail