Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2878
Gene name
LocationContig_198:9367..11406
Strand-
Gene length (bp)2039
Transcript length (bp)1770
Coding sequence length (bp)1770
Protein length (aa) 590

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00642 zf-CCCH Zinc finger C-x8-C-x5-C-x3-H type (and similar) 1.5E-05 33 54
PF00642 zf-CCCH Zinc finger C-x8-C-x5-C-x3-H type (and similar) 2.6E-04 61 77
PF14608 zf-CCCH_2 RNA-binding, Nab2-type zinc finger 9.6E-03 34 53
PF14608 zf-CCCH_2 RNA-binding, Nab2-type zinc finger 3.2E-03 63 81

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P41000|CPS3_SCHPO Protein cps3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cps3 PE=1 SV=3 26 108 3.0E-23
sp|Q02799|LEE1_YEAST Zinc finger protein LEE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LEE1 PE=1 SV=1 31 90 5.0E-21
sp|O74463|YQC1_SCHPO Uncharacterized protein C1739.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1739.01 PE=1 SV=2 29 108 2.0E-18
sp|Q8JFF3|MKRN1_SERQU Probable E3 ubiquitin-protein ligase makorin-1 OS=Seriola quinqueradiata GN=mkrn1 PE=2 SV=1 30 124 1.0E-08
sp|Q5NU14|MKRN1_TAKRU Probable E3 ubiquitin-protein ligase makorin-1 OS=Takifugu rubripes GN=mkrn1 PE=2 SV=1 30 84 1.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P41000|CPS3_SCHPO Protein cps3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cps3 PE=1 SV=3 26 108 3.0E-23
sp|Q02799|LEE1_YEAST Zinc finger protein LEE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LEE1 PE=1 SV=1 31 90 5.0E-21
sp|O74463|YQC1_SCHPO Uncharacterized protein C1739.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1739.01 PE=1 SV=2 29 108 2.0E-18
sp|Q8JFF3|MKRN1_SERQU Probable E3 ubiquitin-protein ligase makorin-1 OS=Seriola quinqueradiata GN=mkrn1 PE=2 SV=1 30 124 1.0E-08
sp|Q5NU14|MKRN1_TAKRU Probable E3 ubiquitin-protein ligase makorin-1 OS=Takifugu rubripes GN=mkrn1 PE=2 SV=1 30 84 1.0E-08
sp|Q9H000|MKRN2_HUMAN Probable E3 ubiquitin-protein ligase makorin-2 OS=Homo sapiens GN=MKRN2 PE=1 SV=2 29 123 2.0E-08
sp|Q6GLD9|MKRN2_XENTR Probable E3 ubiquitin-protein ligase makorin-2 OS=Xenopus tropicalis GN=mkrn2 PE=2 SV=1 29 91 3.0E-08
sp|Q4VBT5|MKRN1_DANRE Probable E3 ubiquitin-protein ligase makorin-1 OS=Danio rerio GN=mkrn1 PE=2 SV=1 30 119 3.0E-08
sp|Q4SRI6|MKRN1_TETNG Probable E3 ubiquitin-protein ligase makorin-1 OS=Tetraodon nigroviridis GN=mkrn1 PE=3 SV=1 24 84 3.0E-08
sp|Q9TT91|MKRN1_MACEU E3 ubiquitin-protein ligase makorin-1 OS=Macropus eugenii GN=MKRN1 PE=2 SV=1 30 118 4.0E-08
sp|Q9DFG8|MKRN2_DANRE Probable E3 ubiquitin-protein ligase makorin-2 OS=Danio rerio GN=mkrn2 PE=2 SV=2 29 87 6.0E-08
sp|B0F0H3|MKRN2_XENLA Probable E3 ubiquitin-protein ligase makorin-2 OS=Xenopus laevis GN=mkrn2 PE=2 SV=2 32 124 2.0E-07
sp|Q5ZA07|C3H41_ORYSJ E3 ubiquitin-protein ligase makorin OS=Oryza sativa subsp. japonica GN=MKRN PE=2 SV=1 30 82 2.0E-07
sp|Q6GLT5|MKRN1_XENLA Probable E3 ubiquitin-protein ligase makorin-1 OS=Xenopus laevis GN=mkrn1 PE=2 SV=1 24 84 5.0E-07
sp|E0X9N4|C3H69_ARATH Zinc finger CCCH domain-containing protein 69 OS=Arabidopsis thaliana GN=At3g63550 PE=3 SV=1 33 82 5.0E-07
sp|Q9UHC7|MKRN1_HUMAN E3 ubiquitin-protein ligase makorin-1 OS=Homo sapiens GN=MKRN1 PE=1 SV=3 30 84 8.0E-07
sp|Q9DD48|MKRN2_SERQU Probable E3 ubiquitin-protein ligase makorin-2 OS=Seriola quinqueradiata GN=mkrn2 PE=2 SV=1 29 87 1.0E-06
sp|Q9ERV1|MKRN2_MOUSE Probable E3 ubiquitin-protein ligase makorin-2 OS=Mus musculus GN=Mkrn2 PE=1 SV=2 29 82 1.0E-06
sp|Q9QXP6|MKRN1_MOUSE E3 ubiquitin-protein ligase makorin-1 OS=Mus musculus GN=Mkrn1 PE=1 SV=1 30 84 2.0E-06
sp|Q657B3|C3H7_ORYSJ Zinc finger CCCH domain-containing protein 7 OS=Oryza sativa subsp. japonica GN=Os01g0572100 PE=2 SV=1 35 122 2.0E-06
sp|Q5NU13|MKRN2_TAKRU Probable E3 ubiquitin-protein ligase makorin-2 OS=Takifugu rubripes GN=mkrn2 PE=2 SV=1 29 82 3.0E-06
sp|Q13434|MKRN4_HUMAN Putative E3 ubiquitin-protein ligase makorin-4 OS=Homo sapiens GN=MKRN4P PE=5 SV=1 30 84 3.0E-06
sp|A6NMK7|CPS4L_HUMAN Putative cleavage and polyadenylation specificity factor subunit 4-like protein OS=Homo sapiens GN=CPSF4L PE=2 SV=3 35 81 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0043167 ion binding No
GO:0043169 cation binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2878
MPEFRHIRGGSLNLGAATGSHMAPRSPPNTSHVPCKFFRQGACQAGNACPFSHDIGAATEAVCKYFAKGNCKFGP
KCANVHVLPDGRRVNYGKNGVTIGAAPINLAASRAPPSPSSPAPPSAVPFRHGSDSALTSLYRADDRQHQHLQHH
QHHQHQQQHLLHPNHLRLRRQPSLENGIPTLDTPYSPSQYGSPRDEDPTRLGFGLSPANAKGLSILDAPLPASFD
SNGISNAARFPSAPWPSSVPSKFGLDSPMQSLSNAKDPRASETLKLLHTSAFGASEHLSTLAVGSPPTPHSVNND
ELFGRRALHSARFSRPKLMSSSVPKQSSVDRDWESEFAFAEDADNVPENYVPENLQDLLTPAEKARRGSMRAESD
SAEGISKYGSPMGSSPSRWGPLFQRQKEEEEITRAARNAASVFGHVGSPLRKSTLAQEMGDDFKVSNGMPRSATA
RTTSESMSVLSQQLQRSRLEESVGGSSPLLHPTAARISANSIGAIGKDRVSERHVSGGSVSSSVTGRFTTPIDEE
DPAFVFTMEEEEDANSTKTRKHAPVSPITMEGFCSFADADAVASKAVSSSAAKDSSDGVSVNGR*
Coding >OphauB2|2878
ATGCCCGAGTTTCGCCACATTCGCGGCGGCAGCCTCAACCTTGGCGCCGCCACCGGAAGCCACATGGCACCGCGA
AGCCCTCCCAACACGTCGCATGTGCCCTGCAAGTTCTTCCGCCAAGGTGCTTGCCAGGCTGGAAATGCCTGTCCC
TTTAGCCACGACATTGGCGCCGCCACCGAGGCCGTCTGCAAATATTTTGCTAAGGGCAACTGCAAGTTTGGTCCC
AAGTGCGCAAATGTCCATGTGCTTCCCGATGGCCGCCGTGTCAACTATGGCAAAAATGGCGTCACCATTGGCGCT
GCGCCCATCAACCTGGCAGCCTCGCGAGCCCCTCCCAGCCCCTCTTCTCCCGCGCCCCCCTCTGCCGTACCCTTT
CGCCATGGCTCCGACAGCGCCCTCACCTCTCTCTACCGCGCCGATGACCGCCAACACCAACATCTCCAGCATCAT
CAACACCATCAGCACCAGCAGCAACACTTATTGCACCCAAACCACTTGCGCTTGCGCCGCCAGCCTAGTCTAGAA
AACGGCATTCCTACTCTTGATACACCCTACTCTCCCTCACAGTACGGCTCGCCCCGCGACGAAGACCCGACTCGT
CTCGGCTTTGGCCTTTCTCCAGCAAACGCAAAGGGCCTCTCCATTCTCGACGCTCCCCTGCCTGCATCCTTTGAC
TCCAATGGCATATCCAATGCCGCCCGCTTTCCATCAGCTCCGTGGCCCTCTTCGGTTCCCTCCAAGTTTGGGCTC
GATTCGCCAATGCAGTCCTTGAGCAACGCCAAGGACCCCCGCGCCTCCGAGACTCTCAAGCTATTGCACACCTCT
GCCTTTGGCGCATCGGAGCACCTCAGTACCCTGGCAGTAGGCAGTCCTCCTACACCACATAGCGTCAACAATGAC
GAATTGTTTGGCCGGAGGGCCCTGCATTCGGCTCGCTTCTCCAGGCCCAAACTCATGAGCTCTAGCGTTCCCAAG
CAGTCTTCGGTTGACCGTGACTGGGAATCAGAGTTTGCATTTGCCGAGGACGCCGACAATGTCCCCGAAAACTAT
GTTCCCGAAAATCTGCAGGATTTACTAACACCAGCTGAAAAGGCTCGTCGGGGGTCCATGCGTGCCGAAAGCGAT
TCAGCCGAGGGCATTTCCAAATATGGTAGTCCCATGGGGTCAAGCCCTAGCAGATGGGGCCCTCTATTCCAGCGA
CAAAAGGAGGAGGAGGAAATCACACGGGCAGCGCGAAACGCAGCCTCTGTGTTTGGCCACGTTGGCAGTCCACTT
CGCAAGTCAACATTGGCTCAAGAGATGGGCGACGACTTTAAAGTCTCGAATGGCATGCCTCGCTCCGCTACTGCT
CGAACCACGAGCGAATCCATGTCCGTCTTGTCACAGCAACTACAGCGCAGCCGACTAGAGGAAAGCGTGGGCGGT
TCGAGCCCTCTGCTGCATCCCACGGCGGCTCGCATTTCTGCCAACAGCATTGGAGCTATTGGAAAGGATCGAGTC
AGTGAGCGACATGTGTCCGGCGGCAGCGTTAGCTCCTCGGTGACGGGTCGCTTCACAACACCGATTGATGAGGAG
GACCCTGCATTCGTTTTCACAATGGAGGAAGAAGAAGACGCAAACTCGACCAAGACTCGCAAGCACGCGCCCGTG
TCGCCCATTACAATGGAAGGCTTCTGCAGCTTCGCCGATGCTGATGCTGTTGCTAGTAAGGCAGTCTCGAGCAGC
GCGGCCAAAGACTCTAGCGATGGCGTCTCGGTGAATGGTCGATGA
Transcript >OphauB2|2878
ATGCCCGAGTTTCGCCACATTCGCGGCGGCAGCCTCAACCTTGGCGCCGCCACCGGAAGCCACATGGCACCGCGA
AGCCCTCCCAACACGTCGCATGTGCCCTGCAAGTTCTTCCGCCAAGGTGCTTGCCAGGCTGGAAATGCCTGTCCC
TTTAGCCACGACATTGGCGCCGCCACCGAGGCCGTCTGCAAATATTTTGCTAAGGGCAACTGCAAGTTTGGTCCC
AAGTGCGCAAATGTCCATGTGCTTCCCGATGGCCGCCGTGTCAACTATGGCAAAAATGGCGTCACCATTGGCGCT
GCGCCCATCAACCTGGCAGCCTCGCGAGCCCCTCCCAGCCCCTCTTCTCCCGCGCCCCCCTCTGCCGTACCCTTT
CGCCATGGCTCCGACAGCGCCCTCACCTCTCTCTACCGCGCCGATGACCGCCAACACCAACATCTCCAGCATCAT
CAACACCATCAGCACCAGCAGCAACACTTATTGCACCCAAACCACTTGCGCTTGCGCCGCCAGCCTAGTCTAGAA
AACGGCATTCCTACTCTTGATACACCCTACTCTCCCTCACAGTACGGCTCGCCCCGCGACGAAGACCCGACTCGT
CTCGGCTTTGGCCTTTCTCCAGCAAACGCAAAGGGCCTCTCCATTCTCGACGCTCCCCTGCCTGCATCCTTTGAC
TCCAATGGCATATCCAATGCCGCCCGCTTTCCATCAGCTCCGTGGCCCTCTTCGGTTCCCTCCAAGTTTGGGCTC
GATTCGCCAATGCAGTCCTTGAGCAACGCCAAGGACCCCCGCGCCTCCGAGACTCTCAAGCTATTGCACACCTCT
GCCTTTGGCGCATCGGAGCACCTCAGTACCCTGGCAGTAGGCAGTCCTCCTACACCACATAGCGTCAACAATGAC
GAATTGTTTGGCCGGAGGGCCCTGCATTCGGCTCGCTTCTCCAGGCCCAAACTCATGAGCTCTAGCGTTCCCAAG
CAGTCTTCGGTTGACCGTGACTGGGAATCAGAGTTTGCATTTGCCGAGGACGCCGACAATGTCCCCGAAAACTAT
GTTCCCGAAAATCTGCAGGATTTACTAACACCAGCTGAAAAGGCTCGTCGGGGGTCCATGCGTGCCGAAAGCGAT
TCAGCCGAGGGCATTTCCAAATATGGTAGTCCCATGGGGTCAAGCCCTAGCAGATGGGGCCCTCTATTCCAGCGA
CAAAAGGAGGAGGAGGAAATCACACGGGCAGCGCGAAACGCAGCCTCTGTGTTTGGCCACGTTGGCAGTCCACTT
CGCAAGTCAACATTGGCTCAAGAGATGGGCGACGACTTTAAAGTCTCGAATGGCATGCCTCGCTCCGCTACTGCT
CGAACCACGAGCGAATCCATGTCCGTCTTGTCACAGCAACTACAGCGCAGCCGACTAGAGGAAAGCGTGGGCGGT
TCGAGCCCTCTGCTGCATCCCACGGCGGCTCGCATTTCTGCCAACAGCATTGGAGCTATTGGAAAGGATCGAGTC
AGTGAGCGACATGTGTCCGGCGGCAGCGTTAGCTCCTCGGTGACGGGTCGCTTCACAACACCGATTGATGAGGAG
GACCCTGCATTCGTTTTCACAATGGAGGAAGAAGAAGACGCAAACTCGACCAAGACTCGCAAGCACGCGCCCGTG
TCGCCCATTACAATGGAAGGCTTCTGCAGCTTCGCCGATGCTGATGCTGTTGCTAGTAAGGCAGTCTCGAGCAGC
GCGGCCAAAGACTCTAGCGATGGCGTCTCGGTGAATGGTCGATGA
Gene >OphauB2|2878
ATGCCCGAGTTTCGCCACATTCGCGGCGGCAGCCTCAACCTTGGCGCCGCCACCGGAAGCCACATGGCACCGCGA
AGCCCTCCCAGTGCGTCGGCCCTCGCTGCAGCTGCACATGAACGACTCTTGTCCTCTGAAGCACTTCCACTACAT
GAAGCGTGCCCACCACATGAAGCCCTCTCACCACATTACCCACCCTCACCCTCGCCCTCACCCTCACCCTCACCC
TCACTTCCATACAAGCCACCCTGCTGCATAAACACTCGTCGCCCATTAGCTGACGCCTCTTCTCTCCCTCGACAG
ACACGTCGCATGTGCCCTGCAAGTTCTTCCGCCAAGGTGCTTGCCAGGCTGGAAATGCCTGTCCCTTTAGCCACG
ACATTGGCGCCGCCACCGAGGCCGTCTGCAAATATTTTGCTAAGGTTGGCTCTCTAGTCTTCACCTGCACCGCCG
CCACTGACTGACGCTCCTTGCAGGGCAACTGCAAGTTTGGTCCCAAGTGCGCAAATGTCCATGTGCTTCCCGATG
GCCGCCGTGTCAACTATGGCAAAAATGGCGTCACCATTGGCGCTGCGCCCATCAACCTGGCAGCCTCGCGAGCCC
CTCCCAGCCCCTCTTCTCCCGCGCCCCCCTCTGCCGTACCCTTTCGCCATGGCTCCGACAGCGCCCTCACCTCTC
TCTACCGCGCCGATGACCGCCAACACCAACATCTCCAGCATCATCAACACCATCAGCACCAGCAGCAACACTTAT
TGCACCCAAACCACTTGCGCTTGCGCCGCCAGCCTAGTCTAGAAAACGGCATTCCTACTCTTGATACACCCTACT
CTCCCTCACAGTACGGCTCGCCCCGCGACGAAGACCCGACTCGTCTCGGCTTTGGCCTTTCTCCAGCAAACGCAA
AGGGCCTCTCCATTCTCGACGCTCCCCTGCCTGCATCCTTTGACTCCAATGGCATATCCAATGCCGCCCGCTTTC
CATCAGCTCCGTGGCCCTCTTCGGTTCCCTCCAAGTTTGGGCTCGATTCGCCAATGCAGTCCTTGAGCAACGCCA
AGGACCCCCGCGCCTCCGAGACTCTCAAGCTATTGCACACCTCTGCCTTTGGCGCATCGGAGCACCTCAGTACCC
TGGCAGTAGGCAGTCCTCCTACACCACATAGCGTCAACAATGACGAATTGTTTGGCCGGAGGGCCCTGCATTCGG
CTCGCTTCTCCAGGCCCAAACTCATGAGCTCTAGCGTTCCCAAGCAGTCTTCGGTTGACCGTGACTGGGAATCAG
AGTTTGCATTTGCCGAGGACGCCGACAATGTCCCCGAAAACTATGTTCCCGAAAATCTGCAGGATTTACTAACAC
CAGCTGAAAAGGCTCGTCGGGGGTCCATGCGTGCCGAAAGCGATTCAGCCGAGGGCATTTCCAAATATGGTAGTC
CCATGGGGTCAAGCCCTAGCAGATGGGGCCCTCTATTCCAGCGACAAAAGGAGGAGGAGGAAATCACACGGGCAG
CGCGAAACGCAGCCTCTGTGTTTGGCCACGTTGGCAGTCCACTTCGCAAGTCAACATTGGCTCAAGAGATGGGCG
ACGACTTTAAAGTCTCGAATGGCATGCCTCGCTCCGCTACTGCTCGAACCACGAGCGAATCCATGTCCGTCTTGT
CACAGCAACTACAGCGCAGCCGACTAGAGGAAAGCGTGGGCGGTTCGAGCCCTCTGCTGCATCCCACGGCGGCTC
GCATTTCTGCCAACAGCATTGGAGCTATTGGAAAGGATCGAGTCAGTGAGCGACATGTGTCCGGCGGCAGCGTTA
GCTCCTCGGTGACGGGTCGCTTCACAACACCGATTGATGAGGAGGACCCTGCATTCGTTTTCACAATGGAGGAAG
AAGAAGACGCAAACTCGACCAAGACTCGCAAGCACGCGCCCGTGTCGCCCATTACAATGGAAGGCTTCTGCAGCT
TCGCCGATGCTGATGCTGTTGCTAGTAAGGCAGTCTCGAGCAGCGCGGCCAAAGACTCTAGCGATGGCGTCTCGG
TGAATGGTCGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail