Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2876
Gene name
LocationContig_198:6048..7490
Strand+
Gene length (bp)1442
Transcript length (bp)1326
Coding sequence length (bp)1326
Protein length (aa) 442

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01494 FAD_binding_3 FAD binding domain 4.3E-27 2 361
PF01266 DAO FAD dependent oxidoreductase 4.1E-07 2 37
PF07992 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreductase 8.6E-08 2 192
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 2.5E-07 5 35
PF05834 Lycopene_cycl Lycopene cyclase protein 1.1E-06 3 162

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9F131|3HBH1_PSEAC 3-hydroxybenzoate 6-hydroxylase 1 OS=Pseudomonas alcaligenes GN=xlnD PE=1 SV=1 2 375 6.0E-34
sp|Q88FY2|6HN3M_PSEPK 6-hydroxynicotinate 3-monooxygenase OS=Pseudomonas putida (strain KT2440) GN=nicC PE=1 SV=1 2 363 2.0E-33
sp|Q3S4B7|3HBH_POLNA 3-hydroxybenzoate 6-hydroxylase OS=Polaromonas naphthalenivorans (strain CJ2) GN=nagX PE=1 SV=1 23 378 4.0E-30
sp|P86491|6HN3M_PSEFL 6-hydroxynicotinate 3-monooxygenase OS=Pseudomonas fluorescens PE=1 SV=1 21 363 2.0E-28
sp|Q5EXK1|3HBH_KLEOX 3-hydroxybenzoate 6-hydroxylase OS=Klebsiella oxytoca GN=mhbM PE=1 SV=1 16 373 3.0E-25
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9F131|3HBH1_PSEAC 3-hydroxybenzoate 6-hydroxylase 1 OS=Pseudomonas alcaligenes GN=xlnD PE=1 SV=1 2 375 6.0E-34
sp|Q88FY2|6HN3M_PSEPK 6-hydroxynicotinate 3-monooxygenase OS=Pseudomonas putida (strain KT2440) GN=nicC PE=1 SV=1 2 363 2.0E-33
sp|Q3S4B7|3HBH_POLNA 3-hydroxybenzoate 6-hydroxylase OS=Polaromonas naphthalenivorans (strain CJ2) GN=nagX PE=1 SV=1 23 378 4.0E-30
sp|P86491|6HN3M_PSEFL 6-hydroxynicotinate 3-monooxygenase OS=Pseudomonas fluorescens PE=1 SV=1 21 363 2.0E-28
sp|Q5EXK1|3HBH_KLEOX 3-hydroxybenzoate 6-hydroxylase OS=Klebsiella oxytoca GN=mhbM PE=1 SV=1 16 373 3.0E-25
sp|Q53552|NHG2_PSEPU Salicylate hydroxylase OS=Pseudomonas putida GN=nahG PE=4 SV=1 1 385 7.0E-23
sp|Q8NLB6|3HBH_CORGL 3-hydroxybenzoate 6-hydroxylase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=Cgl3026 PE=1 SV=1 26 319 3.0E-22
sp|Q40412|ABA2_NICPL Zeaxanthin epoxidase, chloroplastic OS=Nicotiana plumbaginifolia GN=ABA2 PE=1 SV=1 1 360 2.0E-16
sp|P23262|NHG1_PSEPU Salicylate hydroxylase OS=Pseudomonas putida GN=nahG PE=1 SV=4 14 374 3.0E-16
sp|Q0QFQ1|3HBH2_PSEAC 3-hydroxybenzoate 6-hydroxylase 2 OS=Pseudomonas alcaligenes GN=hbzD PE=2 SV=1 96 378 4.0E-16
sp|P93236|ABA2_SOLLC Zeaxanthin epoxidase, chloroplastic OS=Solanum lycopersicum PE=2 SV=1 1 360 6.0E-16
sp|B2FL98|KMO_STRMK Kynurenine 3-monooxygenase OS=Stenotrophomonas maltophilia (strain K279a) GN=kmo PE=3 SV=1 5 397 1.0E-15
sp|A6T923|HPXO_KLEP7 FAD-dependent urate hydroxylase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=hpxO PE=1 SV=1 1 374 4.0E-15
sp|B6D1N4|HPXO_KLEPN FAD-dependent urate hydroxylase OS=Klebsiella pneumoniae GN=hpxO PE=3 SV=1 1 354 6.0E-15
sp|O06489|YETM_BACSU Putative oxidoreductase YetM OS=Bacillus subtilis (strain 168) GN=yetM PE=3 SV=1 17 363 1.0E-14
sp|Q8PM34|KMO_XANAC Kynurenine 3-monooxygenase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=kmo PE=3 SV=1 3 327 4.0E-14
sp|Q3BV41|KMO_XANC5 Kynurenine 3-monooxygenase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=kmo PE=3 SV=1 3 327 2.0E-13
sp|B0RV00|KMO_XANCB Kynurenine 3-monooxygenase OS=Xanthomonas campestris pv. campestris (strain B100) GN=kmo PE=3 SV=1 3 327 4.0E-13
sp|Q5H038|KMO_XANOR Kynurenine 3-monooxygenase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=kmo PE=3 SV=1 3 327 6.0E-13
sp|B2SIT6|KMO_XANOP Kynurenine 3-monooxygenase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=kmo PE=3 SV=2 3 327 7.0E-13
sp|Q2P316|KMO_XANOM Kynurenine 3-monooxygenase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=kmo PE=3 SV=1 3 327 8.0E-13
sp|Q8PAD3|KMO_XANCP Kynurenine 3-monooxygenase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=kmo PE=3 SV=1 3 327 1.0E-12
sp|Q4UT92|KMO_XANC8 Kynurenine 3-monooxygenase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=kmo PE=3 SV=1 3 327 1.0E-12
sp|Q9FGC7|ZEP_ARATH Zeaxanthin epoxidase, chloroplastic OS=Arabidopsis thaliana GN=ZEP PE=1 SV=1 2 355 2.0E-12
sp|O81360|ABA2_PRUAR Zeaxanthin epoxidase, chloroplastic OS=Prunus armeniaca PE=2 SV=1 1 360 4.0E-12
sp|Q84HF5|KMO_PSEFL Kynurenine 3-monooxygenase OS=Pseudomonas fluorescens GN=kmo PE=1 SV=1 2 326 2.0E-10
sp|A3Q339|MHPA_MYCSJ 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Mycobacterium sp. (strain JLS) GN=mhpA PE=3 SV=1 3 378 3.0E-10
sp|A1UJP4|MHPA_MYCSK 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Mycobacterium sp. (strain KMS) GN=mhpA PE=3 SV=1 3 322 5.0E-10
sp|Q1B5E2|MHPA_MYCSS 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Mycobacterium sp. (strain MCS) GN=mhpA PE=3 SV=1 3 322 5.0E-10
sp|A1TCX2|MHPA_MYCVP 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=mhpA PE=3 SV=1 7 368 5.0E-10
sp|A8LVF4|KMO_SALAI Kynurenine 3-monooxygenase OS=Salinispora arenicola (strain CNS-205) GN=kmo PE=3 SV=1 7 326 5.0E-09
sp|D4B1Y1|A2462_ARTBC Probable FAD-dependent monooxygenase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02462 PE=3 SV=1 3 391 8.0E-09
sp|B5B0J6|HPXO_KLEOX FAD-dependent urate hydroxylase OS=Klebsiella oxytoca GN=hpxO PE=3 SV=1 1 377 3.0E-08
sp|A4XD40|KMO_SALTO Kynurenine 3-monooxygenase OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=kmo PE=3 SV=1 7 326 5.0E-08
sp|A0R1T4|MHPA_MYCS2 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=mhpA PE=3 SV=2 1 322 2.0E-07
sp|Q54530|DNRF_STREF Aklavinone 12-hydroxylase RdmE OS=Streptomyces purpurascens GN=rdmE PE=1 SV=1 1 359 5.0E-07
sp|Q742Z1|MHPA_MYCPA 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mhpA PE=3 SV=1 3 322 9.0E-07
sp|Q54RE8|KMO_DICDI Kynurenine 3-monooxygenase OS=Dictyostelium discoideum GN=kmo PE=3 SV=1 241 397 3.0E-06
sp|A0QB57|MHPA_MYCA1 3-(3-hydroxy-phenyl)propionate/3-hydroxycinnamic acid hydroxylase OS=Mycobacterium avium (strain 104) GN=mhpA PE=3 SV=1 3 322 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0071949 FAD binding Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0036094 small molecule binding No
GO:0043168 anion binding No
GO:0050660 flavin adenine dinucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2876
MKIIIVGAGIAGLSLAVALSQAGHSVTVLDSAAQLAELGAGVQMTPQAVKYFFQWGLKQDILADAIIPQAIHVRD
GTRGDLLGTVNVASMEAQYGAPYIVVHRAALHAILHAHAVKAGAQIKLASRVVKYDFDNGGCELQDGKRLEADLV
VAADGINSTARAQLLGPLDPGSQPTGWAAFRMMTSVSKLRDDPVTADLANLETGSSGLWIAPNRSCMTYLVKEGT
MLNVVLSHPDDVDTRNFSPQEYKKTVDDMFQDFEPRVQKIMSLAEPKIVNYPVYAVPPLPHWAHESGRFTLIGDA
AHAMAFYMSMGVSLAVEDAVSLTKALDLAAPPNTPLDSSRLKHALNVYQSVRKRRAEAVQRASLHAGNSMHVADG
QDRDFMLEALKHAHEDITWPPRESREHSRVLQGVNGERLGPGGFTDKGTRDWCYGYDAIADIAAAY*
Coding >OphauB2|2876
ATGAAGATTATTATTGTTGGTGCCGGCATCGCCGGTCTCTCGCTTGCCGTTGCCCTCTCCCAAGCAGGCCACTCA
GTCACGGTGCTCGACTCAGCAGCACAGCTAGCCGAGCTGGGCGCCGGCGTGCAAATGACTCCGCAGGCGGTAAAG
TACTTTTTCCAATGGGGTCTCAAGCAAGACATTCTCGCCGATGCCATTATTCCCCAGGCCATACATGTGCGGGAC
GGCACGAGGGGCGACTTGCTGGGCACGGTCAATGTAGCGAGCATGGAAGCTCAGTATGGAGCTCCGTACATTGTT
GTTCATCGTGCAGCCCTGCATGCCATTTTGCATGCCCATGCCGTCAAGGCGGGAGCGCAAATCAAGCTGGCGAGC
AGGGTGGTCAAGTATGATTTTGATAACGGCGGCTGTGAGTTGCAGGACGGCAAGAGGCTCGAAGCAGACCTGGTT
GTTGCGGCAGATGGCATAAACTCGACTGCACGGGCCCAGCTTCTCGGGCCTCTGGATCCCGGGAGCCAGCCAACT
GGCTGGGCAGCTTTTCGAATGATGACTTCTGTGTCCAAGCTGCGAGACGATCCGGTAACAGCCGACTTGGCCAAC
CTCGAAACCGGCAGCTCTGGTCTCTGGATTGCACCCAATCGGTCGTGCATGACGTATCTCGTCAAGGAGGGAACC
ATGCTCAATGTCGTCTTGTCCCATCCCGATGACGTGGACACGAGGAATTTCAGTCCCCAAGAGTATAAAAAAACA
GTCGACGACATGTTTCAAGACTTTGAGCCGCGCGTACAAAAGATTATGAGCCTCGCTGAGCCCAAAATCGTCAAT
TATCCCGTCTACGCCGTCCCACCACTCCCACACTGGGCCCATGAATCAGGACGCTTCACACTGATTGGAGACGCA
GCCCACGCCATGGCCTTTTACATGTCCATGGGCGTCAGCCTAGCCGTCGAAGACGCCGTCAGCCTAACCAAGGCG
CTCGACCTTGCCGCTCCTCCAAACACCCCCCTCGACTCTTCAAGACTAAAACACGCTCTCAATGTCTACCAATCG
GTGCGCAAACGCAGAGCAGAAGCCGTGCAGCGCGCCAGCCTACACGCTGGCAACTCGATGCACGTTGCCGACGGC
CAGGACCGAGATTTTATGCTCGAGGCGCTCAAACACGCACATGAGGATATCACTTGGCCGCCAAGAGAAAGCAGA
GAGCATTCCAGGGTCTTGCAGGGCGTCAATGGCGAGCGGCTTGGTCCGGGGGGGTTCACGGACAAGGGAACGCGG
GACTGGTGTTATGGCTACGACGCCATTGCGGATATTGCTGCAGCGTATTGA
Transcript >OphauB2|2876
ATGAAGATTATTATTGTTGGTGCCGGCATCGCCGGTCTCTCGCTTGCCGTTGCCCTCTCCCAAGCAGGCCACTCA
GTCACGGTGCTCGACTCAGCAGCACAGCTAGCCGAGCTGGGCGCCGGCGTGCAAATGACTCCGCAGGCGGTAAAG
TACTTTTTCCAATGGGGTCTCAAGCAAGACATTCTCGCCGATGCCATTATTCCCCAGGCCATACATGTGCGGGAC
GGCACGAGGGGCGACTTGCTGGGCACGGTCAATGTAGCGAGCATGGAAGCTCAGTATGGAGCTCCGTACATTGTT
GTTCATCGTGCAGCCCTGCATGCCATTTTGCATGCCCATGCCGTCAAGGCGGGAGCGCAAATCAAGCTGGCGAGC
AGGGTGGTCAAGTATGATTTTGATAACGGCGGCTGTGAGTTGCAGGACGGCAAGAGGCTCGAAGCAGACCTGGTT
GTTGCGGCAGATGGCATAAACTCGACTGCACGGGCCCAGCTTCTCGGGCCTCTGGATCCCGGGAGCCAGCCAACT
GGCTGGGCAGCTTTTCGAATGATGACTTCTGTGTCCAAGCTGCGAGACGATCCGGTAACAGCCGACTTGGCCAAC
CTCGAAACCGGCAGCTCTGGTCTCTGGATTGCACCCAATCGGTCGTGCATGACGTATCTCGTCAAGGAGGGAACC
ATGCTCAATGTCGTCTTGTCCCATCCCGATGACGTGGACACGAGGAATTTCAGTCCCCAAGAGTATAAAAAAACA
GTCGACGACATGTTTCAAGACTTTGAGCCGCGCGTACAAAAGATTATGAGCCTCGCTGAGCCCAAAATCGTCAAT
TATCCCGTCTACGCCGTCCCACCACTCCCACACTGGGCCCATGAATCAGGACGCTTCACACTGATTGGAGACGCA
GCCCACGCCATGGCCTTTTACATGTCCATGGGCGTCAGCCTAGCCGTCGAAGACGCCGTCAGCCTAACCAAGGCG
CTCGACCTTGCCGCTCCTCCAAACACCCCCCTCGACTCTTCAAGACTAAAACACGCTCTCAATGTCTACCAATCG
GTGCGCAAACGCAGAGCAGAAGCCGTGCAGCGCGCCAGCCTACACGCTGGCAACTCGATGCACGTTGCCGACGGC
CAGGACCGAGATTTTATGCTCGAGGCGCTCAAACACGCACATGAGGATATCACTTGGCCGCCAAGAGAAAGCAGA
GAGCATTCCAGGGTCTTGCAGGGCGTCAATGGCGAGCGGCTTGGTCCGGGGGGGTTCACGGACAAGGGAACGCGG
GACTGGTGTTATGGCTACGACGCCATTGCGGATATTGCTGCAGCGTATTGA
Gene >OphauB2|2876
ATGAAGATTATTATTGTTGGTGCCGGCATCGCCGGTCTCTCGCTTGCCGTTGCCCTCTCCCAAGCAGGCCACTCA
GTCACGGTGCTCGACTCAGCAGCACAGCTAGCCGAGCTGGGCGCCGGCGTGCAAATGACTCCGCAGGCGGTAAAG
TACTTTTTCCAATGGGGTCTCAAGCAAGACATTCTCGCCGATGCCATTATTCCCCAGGCCATACATGTGCGGGAC
GGCACGAGGGGCGACTTGCTGGGCACGGTCAATGTAGCGAGCATGGAAGCTCAGTATGGAGCTCCGTACATTGTT
GTTCATCGTGCAGCCCTGCATGCCATTTTGCATGCCCATGCCGTCAAGGCGGGAGCGCAAATCAAGCTGGCGAGC
AGGGTGGTCAAGTATGATTTTGATAACGGCGGCTGTGAGTTGCAGGACGGCAAGAGGCTCGAAGCAGACCTGGTT
GTTGCGGCAGATGGTATGCTTGCCACGCGTCATGTAGGTGCTCAAAGATGGATAGACACTGATTGTTGCTTGCAG
GCATAAACTCGACTGCACGGGCCCAGCTTCTCGGGCCTCTGGATCCCGGGAGCCAGCCAACTGGCTGGGCAGCTT
TTCGAATGATGACTTCTGTGTCCAAGCTGCGAGACGATCCGGTAACAGCCGACTTGGCCAACCTCGAAACCGGCA
GCTCTGGTCTCTGGATTGCACCCAATCGGTCGTGCATGACGTATCTCGTCAAGGAGGGAACCATGCTCAATGTCG
TCTTGTCCCATCCCGATGACGTGGACACGAGGAATTTCAGTCCCCAAGAGTATAAAAAAACAGTCGACGACATGT
TTCAAGACTTTGAGCCGCGGCATGTCCCACTAGACCTTGTATCAAACCGTCCTGATTCTAACCCGCAACACAGCG
TACAAAAGATTATGAGCCTCGCTGAGCCCAAAATCGTCAATTATCCCGTCTACGCCGTCCCACCACTCCCACACT
GGGCCCATGAATCAGGACGCTTCACACTGATTGGAGACGCAGCCCACGCCATGGCCTTTTACATGTCCATGGGCG
TCAGCCTAGCCGTCGAAGACGCCGTCAGCCTAACCAAGGCGCTCGACCTTGCCGCTCCTCCAAACACCCCCCTCG
ACTCTTCAAGACTAAAACACGCTCTCAATGTCTACCAATCGGTGCGCAAACGCAGAGCAGAAGCCGTGCAGCGCG
CCAGCCTACACGCTGGCAACTCGATGCACGTTGCCGACGGCCAGGACCGAGATTTTATGCTCGAGGCGCTCAAAC
ACGCACATGAGGATATCACTTGGCCGCCAAGAGAAAGCAGAGAGCATTCCAGGGTCTTGCAGGGCGTCAATGGCG
AGCGGCTTGGTCCGGGGGGGTTCACGGACAAGGGAACGCGGGACTGGTGTTATGGCTACGACGCCATTGCGGATA
TTGCTGCAGCGTATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail