Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2874
Gene name
LocationContig_198:1873..2922
Strand+
Gene length (bp)1049
Transcript length (bp)630
Coding sequence length (bp)630
Protein length (aa) 210

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00037 Fer4 4Fe-4S binding domain 3.6E-05 107 126
PF00037 Fer4 4Fe-4S binding domain 6.0E-08 143 164
PF12838 Fer4_7 4Fe-4S dicluster domain 1.7E-12 109 163
PF13237 Fer4_10 4Fe-4S dicluster domain 3.3E-06 107 160
PF13187 Fer4_9 4Fe-4S dicluster domain 2.3E-07 109 164
PF12800 Fer4_4 4Fe-4S binding domain 5.1E-04 108 122

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12644|NDUS8_NEUCR NADH-ubiquinone oxidoreductase 23 kDa subunit, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nuo21.3c PE=2 SV=1 11 209 2.0E-118
sp|Q60HE3|NDUS8_MACFA NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial OS=Macaca fascicularis GN=NDUFS8 PE=2 SV=1 44 209 8.0E-88
sp|P0CB97|NDUS8_PONAB NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial OS=Pongo abelii GN=NDUFS8 PE=2 SV=1 44 209 1.0E-87
sp|Q8K3J1|NDUS8_MOUSE NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial OS=Mus musculus GN=Ndufs8 PE=1 SV=1 52 209 1.0E-87
sp|P42028|NDUS8_BOVIN NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial OS=Bos taurus GN=NDUFS8 PE=1 SV=1 9 209 2.0E-87
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12644|NDUS8_NEUCR NADH-ubiquinone oxidoreductase 23 kDa subunit, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nuo21.3c PE=2 SV=1 11 209 2.0E-118
sp|Q60HE3|NDUS8_MACFA NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial OS=Macaca fascicularis GN=NDUFS8 PE=2 SV=1 44 209 8.0E-88
sp|P0CB97|NDUS8_PONAB NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial OS=Pongo abelii GN=NDUFS8 PE=2 SV=1 44 209 1.0E-87
sp|Q8K3J1|NDUS8_MOUSE NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial OS=Mus musculus GN=Ndufs8 PE=1 SV=1 52 209 1.0E-87
sp|P42028|NDUS8_BOVIN NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial OS=Bos taurus GN=NDUFS8 PE=1 SV=1 9 209 2.0E-87
sp|P0CB98|NDUS8_PONPY NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial OS=Pongo pygmaeus GN=NDUFS8 PE=2 SV=1 15 209 6.0E-87
sp|Q0MQI3|NDUS8_PANTR NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial OS=Pan troglodytes GN=NDUFS8 PE=2 SV=1 15 209 6.0E-87
sp|O00217|NDUS8_HUMAN NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial OS=Homo sapiens GN=NDUFS8 PE=1 SV=1 15 209 6.0E-87
sp|Q0MQI2|NDUS8_GORGO NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial OS=Gorilla gorilla gorilla GN=NDUFS8 PE=2 SV=1 15 209 2.0E-86
sp|Q9FX83|NDS8B_ARATH NADH dehydrogenase [ubiquinone] iron-sulfur protein 8-B, mitochondrial OS=Arabidopsis thaliana GN=At1g16700 PE=2 SV=1 3 209 3.0E-86
sp|P80269|NDUS8_SOLTU NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial OS=Solanum tuberosum PE=1 SV=2 3 209 1.0E-85
sp|Q42599|NDS8A_ARATH NADH dehydrogenase [ubiquinone] iron-sulfur protein 8-A, mitochondrial OS=Arabidopsis thaliana GN=At1g79010 PE=2 SV=1 2 209 3.0E-85
sp|Q0BSL0|NUOI_GRABC NADH-quinone oxidoreductase subunit I OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=nuoI PE=3 SV=1 49 209 3.0E-84
sp|Q2G5Z4|NUOI_NOVAD NADH-quinone oxidoreductase subunit I OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=nuoI PE=3 SV=1 51 209 1.0E-82
sp|O24143|NDUS8_TOBAC NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial OS=Nicotiana tabacum PE=2 SV=1 8 209 2.0E-82
sp|O21233|NDUS8_RECAM NADH-ubiquinone oxidoreductase subunit 8 OS=Reclinomonas americana GN=NAD8 PE=3 SV=1 50 209 2.0E-82
sp|Q5LPS9|NUOI_RUEPO NADH-quinone oxidoreductase subunit I OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=nuoI PE=3 SV=1 53 209 4.0E-82
sp|Q22619|NDUS8_CAEEL Probable NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial OS=Caenorhabditis elegans GN=T20H4.5 PE=2 SV=1 33 209 5.0E-82
sp|Q2W3J2|NUOI_MAGSA NADH-quinone oxidoreductase subunit I OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=nuoI PE=3 SV=1 49 209 2.0E-81
sp|Q2NA74|NUOI_ERYLH NADH-quinone oxidoreductase subunit I OS=Erythrobacter litoralis (strain HTCC2594) GN=nuoI PE=3 SV=1 53 209 4.0E-81
sp|A8I407|NUOI_AZOC5 NADH-quinone oxidoreductase subunit I OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=nuoI PE=3 SV=1 51 209 7.0E-81
sp|A8LIV0|NUOI_DINSH NADH-quinone oxidoreductase subunit I OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=nuoI PE=3 SV=1 53 209 1.0E-80
sp|B6ISX3|NUOI_RHOCS NADH-quinone oxidoreductase subunit I OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=nuoI PE=3 SV=1 51 209 1.0E-80
sp|Q1GIM9|NUOI_RUEST NADH-quinone oxidoreductase subunit I OS=Ruegeria sp. (strain TM1040) GN=nuoI PE=3 SV=1 53 209 4.0E-80
sp|Q28T58|NUOI_JANSC NADH-quinone oxidoreductase subunit I OS=Jannaschia sp. (strain CCS1) GN=nuoI PE=3 SV=1 53 209 6.0E-80
sp|Q3J3F0|NUOI1_RHOS4 NADH-quinone oxidoreductase subunit I 1 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=nuoI1 PE=3 SV=1 53 209 7.0E-80
sp|A3PIX9|NUOI1_RHOS1 NADH-quinone oxidoreductase subunit I 1 OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=nuoI1 PE=3 SV=1 53 209 7.0E-80
sp|A7IP99|NUOI_XANP2 NADH-quinone oxidoreductase subunit I OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=nuoI PE=3 SV=1 51 209 4.0E-79
sp|Q4FM83|NUOI_PELUB NADH-quinone oxidoreductase subunit I OS=Pelagibacter ubique (strain HTCC1062) GN=nuoI PE=3 SV=1 51 209 6.0E-79
sp|P29921|NQO9_PARDE NADH-quinone oxidoreductase subunit 9 OS=Paracoccus denitrificans GN=nqo9 PE=3 SV=1 53 209 7.0E-79
sp|A1B486|NUOI_PARDP NADH-quinone oxidoreductase subunit I OS=Paracoccus denitrificans (strain Pd 1222) GN=nuoI PE=1 SV=1 53 209 1.0E-78
sp|P42031|NUOI_RHOCA NADH-quinone oxidoreductase subunit I OS=Rhodobacter capsulatus GN=nuoI PE=3 SV=1 53 209 3.0E-78
sp|Q2RU32|NUOI_RHORT NADH-quinone oxidoreductase subunit I OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=nuoI PE=3 SV=1 62 209 4.0E-78
sp|Q163R7|NUOI_ROSDO NADH-quinone oxidoreductase subunit I OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=nuoI PE=3 SV=1 53 209 7.0E-78
sp|Q73GH4|NUOI_WOLPM NADH-quinone oxidoreductase subunit I OS=Wolbachia pipientis wMel GN=nuoI PE=3 SV=1 50 208 1.0E-77
sp|Q98KR4|NUOI_RHILO NADH-quinone oxidoreductase subunit I OS=Rhizobium loti (strain MAFF303099) GN=nuoI PE=3 SV=1 51 209 4.0E-77
sp|Q1GTK7|NUOI_SPHAL NADH-quinone oxidoreductase subunit I OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=nuoI PE=3 SV=1 51 209 4.0E-77
sp|Q5GSG5|NUOI_WOLTR NADH-quinone oxidoreductase subunit I OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=nuoI PE=3 SV=1 50 209 5.0E-77
sp|Q2GJS3|NUOI_ANAPZ NADH-quinone oxidoreductase subunit I OS=Anaplasma phagocytophilum (strain HZ) GN=nuoI PE=3 SV=1 59 208 6.0E-77
sp|Q9ZCF8|NUOI_RICPR NADH-quinone oxidoreductase subunit I OS=Rickettsia prowazekii (strain Madrid E) GN=nuoI PE=3 SV=1 50 209 7.0E-77
sp|C3PLS5|NUOI_RICAE NADH-quinone oxidoreductase subunit I OS=Rickettsia africae (strain ESF-5) GN=nuoI PE=3 SV=1 50 209 8.0E-77
sp|Q92G94|NUOI_RICCN NADH-quinone oxidoreductase subunit I OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=nuoI PE=3 SV=1 50 209 1.0E-76
sp|C4K221|NUOI_RICPU NADH-quinone oxidoreductase subunit I OS=Rickettsia peacockii (strain Rustic) GN=nuoI PE=3 SV=1 50 209 2.0E-76
sp|Q1QL93|NUOI_NITHX NADH-quinone oxidoreductase subunit I OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=nuoI PE=3 SV=1 51 209 2.0E-76
sp|A8GTS0|NUOI_RICRS NADH-quinone oxidoreductase subunit I OS=Rickettsia rickettsii (strain Sheila Smith) GN=nuoI PE=3 SV=1 50 209 3.0E-76
sp|B0BVB0|NUOI_RICRO NADH-quinone oxidoreductase subunit I OS=Rickettsia rickettsii (strain Iowa) GN=nuoI PE=3 SV=1 50 209 3.0E-76
sp|Q4UK24|NUOI_RICFE NADH-quinone oxidoreductase subunit I OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=nuoI PE=3 SV=1 50 209 3.0E-76
sp|B0CLD7|NUOI_BRUSI NADH-quinone oxidoreductase subunit I OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=nuoI PE=3 SV=1 51 209 3.0E-76
sp|Q8G1A9|NUOI_BRUSU NADH-quinone oxidoreductase subunit I OS=Brucella suis biovar 1 (strain 1330) GN=nuoI PE=3 SV=1 51 209 3.0E-76
sp|A9MAI7|NUOI_BRUC2 NADH-quinone oxidoreductase subunit I OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=nuoI PE=3 SV=1 51 209 3.0E-76
sp|A5VPZ1|NUOI_BRUO2 NADH-quinone oxidoreductase subunit I OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=nuoI PE=3 SV=1 51 209 5.0E-76
sp|C0RIE7|NUOI_BRUMB NADH-quinone oxidoreductase subunit I OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=nuoI PE=3 SV=1 51 209 5.0E-76
sp|Q57DU3|NUOI_BRUAB NADH-quinone oxidoreductase subunit I OS=Brucella abortus biovar 1 (strain 9-941) GN=nuoI PE=3 SV=1 51 209 5.0E-76
sp|Q2YNF5|NUOI_BRUA2 NADH-quinone oxidoreductase subunit I OS=Brucella abortus (strain 2308) GN=nuoI PE=3 SV=1 51 209 5.0E-76
sp|B2S551|NUOI_BRUA1 NADH-quinone oxidoreductase subunit I OS=Brucella abortus (strain S19) GN=nuoI PE=3 SV=1 51 209 5.0E-76
sp|A6X1M5|NUOI_OCHA4 NADH-quinone oxidoreductase subunit I OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=nuoI PE=3 SV=1 55 209 6.0E-76
sp|Q8YGK8|NUOI_BRUME NADH-quinone oxidoreductase subunit I OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=nuoI PE=3 SV=1 51 209 7.0E-76
sp|Q6N5N2|NUOI1_RHOPA NADH-quinone oxidoreductase subunit I 1 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=nuoI1 PE=3 SV=1 58 209 7.0E-76
sp|Q89KJ6|NUOI_BRADU NADH-quinone oxidoreductase subunit I OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=nuoI PE=3 SV=1 51 209 8.0E-76
sp|Q0C1D6|NUOI_HYPNA NADH-quinone oxidoreductase subunit I OS=Hyphomonas neptunium (strain ATCC 15444) GN=nuoI PE=3 SV=1 59 209 9.0E-76
sp|B3CUK1|NUOI_ORITI NADH-quinone oxidoreductase subunit I OS=Orientia tsutsugamushi (strain Ikeda) GN=nuoI PE=3 SV=1 51 209 9.0E-76
sp|A5CFN6|NUOI_ORITB NADH-quinone oxidoreductase subunit I OS=Orientia tsutsugamushi (strain Boryong) GN=nuoI PE=3 SV=1 51 209 9.0E-76
sp|A8GPY5|NUOI_RICAH NADH-quinone oxidoreductase subunit I OS=Rickettsia akari (strain Hartford) GN=nuoI PE=3 SV=1 50 209 1.0E-75
sp|Q3SRF2|NUOI_NITWN NADH-quinone oxidoreductase subunit I OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=nuoI PE=3 SV=1 51 209 1.0E-75
sp|Q11JJ8|NUOI_CHESB NADH-quinone oxidoreductase subunit I OS=Chelativorans sp. (strain BNC1) GN=nuoI PE=3 SV=1 51 209 1.0E-75
sp|A7HY41|NUOI_PARL1 NADH-quinone oxidoreductase subunit I OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=nuoI PE=3 SV=1 51 209 1.0E-75
sp|B1LUM8|NUOI_METRJ NADH-quinone oxidoreductase subunit I OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=nuoI PE=3 SV=1 51 209 1.0E-75
sp|Q135Y4|NUOI2_RHOPS NADH-quinone oxidoreductase subunit I 2 OS=Rhodopseudomonas palustris (strain BisB5) GN=nuoI2 PE=3 SV=1 51 209 1.0E-75
sp|A8F2T4|NUOI_RICM5 NADH-quinone oxidoreductase subunit I OS=Rickettsia massiliae (strain Mtu5) GN=nuoI PE=3 SV=2 50 209 2.0E-75
sp|Q68VV4|NUOI_RICTY NADH-quinone oxidoreductase subunit I OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=nuoI PE=3 SV=1 50 209 2.0E-75
sp|Q92QP4|NUOI1_RHIME NADH-quinone oxidoreductase subunit I 1 OS=Rhizobium meliloti (strain 1021) GN=nuoI1 PE=3 SV=1 49 209 2.0E-75
sp|A9W1M5|NUOI_METEP NADH-quinone oxidoreductase subunit I OS=Methylobacterium extorquens (strain PA1) GN=nuoI PE=3 SV=1 51 209 2.0E-75
sp|B7KQ58|NUOI_METC4 NADH-quinone oxidoreductase subunit I OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=nuoI PE=3 SV=1 51 209 2.0E-75
sp|Q215H2|NUOI1_RHOPB NADH-quinone oxidoreductase subunit I 1 OS=Rhodopseudomonas palustris (strain BisB18) GN=nuoI1 PE=3 SV=1 58 209 2.0E-75
sp|B8IUV4|NUOI_METNO NADH-quinone oxidoreductase subunit I OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=nuoI PE=3 SV=1 51 209 3.0E-75
sp|Q2IWX5|NUOI2_RHOP2 NADH-quinone oxidoreductase subunit I 2 OS=Rhodopseudomonas palustris (strain HaA2) GN=nuoI2 PE=3 SV=1 51 209 4.0E-75
sp|Q5PAK7|NUOI_ANAMM NADH-quinone oxidoreductase subunit I OS=Anaplasma marginale (strain St. Maries) GN=nuoI PE=3 SV=1 57 208 5.0E-75
sp|A5EK90|NUOI_BRASB NADH-quinone oxidoreductase subunit I OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=nuoI PE=3 SV=1 58 209 6.0E-75
sp|Q8UFW9|NUOI_AGRFC NADH-quinone oxidoreductase subunit I OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=nuoI PE=3 SV=1 58 209 6.0E-75
sp|B1ZA38|NUOI_METPB NADH-quinone oxidoreductase subunit I OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=nuoI PE=3 SV=1 51 209 8.0E-75
sp|Q2GGD7|NUOI_EHRCR NADH-quinone oxidoreductase subunit I OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=nuoI PE=3 SV=1 65 208 8.0E-75
sp|Q1RKD0|NUOI_RICBR NADH-quinone oxidoreductase subunit I OS=Rickettsia bellii (strain RML369-C) GN=nuoI PE=3 SV=1 50 209 8.0E-75
sp|A8GY32|NUOI_RICB8 NADH-quinone oxidoreductase subunit I OS=Rickettsia bellii (strain OSU 85-389) GN=nuoI PE=3 SV=1 50 209 8.0E-75
sp|Q07NL5|NUOI2_RHOP5 NADH-quinone oxidoreductase subunit I 2 OS=Rhodopseudomonas palustris (strain BisA53) GN=nuoI2 PE=3 SV=1 58 209 1.0E-74
sp|A4YVK2|NUOI_BRASO NADH-quinone oxidoreductase subunit I OS=Bradyrhizobium sp. (strain ORS278) GN=nuoI PE=3 SV=1 58 209 1.0E-74
sp|B0ULL2|NUOI_METS4 NADH-quinone oxidoreductase subunit I OS=Methylobacterium sp. (strain 4-46) GN=nuoI PE=3 SV=1 51 209 1.0E-74
sp|B6JH51|NUOI_OLICO NADH-quinone oxidoreductase subunit I OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=nuoI PE=3 SV=1 58 209 3.0E-74
sp|Q3YSA1|NUOI_EHRCJ NADH-quinone oxidoreductase subunit I OS=Ehrlichia canis (strain Jake) GN=nuoI PE=3 SV=1 54 208 4.0E-74
sp|Q6G396|NUOI_BARHE NADH-quinone oxidoreductase subunit I OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=nuoI PE=3 SV=1 51 209 4.0E-74
sp|Q0APY2|NUOI_MARMM NADH-quinone oxidoreductase subunit I OS=Maricaulis maris (strain MCS10) GN=nuoI PE=3 SV=1 59 209 5.0E-74
sp|Q1MIK6|NUOI_RHIL3 NADH-quinone oxidoreductase subunit I OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=nuoI PE=3 SV=1 58 209 5.0E-74
sp|A9IUN3|NUOI_BART1 NADH-quinone oxidoreductase subunit I OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=nuoI PE=3 SV=1 55 209 1.0E-73
sp|Q2K9S4|NUOI1_RHIEC NADH-quinone oxidoreductase subunit I 1 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=nuoI1 PE=3 SV=1 58 209 1.0E-73
sp|Q6FZY3|NUOI_BARQU NADH-quinone oxidoreductase subunit I OS=Bartonella quintana (strain Toulouse) GN=nuoI PE=3 SV=1 51 209 2.0E-73
sp|B9JVF4|NUOI_AGRVS NADH-quinone oxidoreductase subunit I OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=nuoI PE=3 SV=1 58 209 5.0E-73
sp|A1USX5|NUOI_BARBK NADH-quinone oxidoreductase subunit I OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=nuoI PE=3 SV=1 51 209 9.0E-73
sp|B5ZYM2|NUOI_RHILW NADH-quinone oxidoreductase subunit I OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=nuoI PE=3 SV=1 62 209 2.0E-72
sp|A8EZZ7|NUOI_RICCK NADH-quinone oxidoreductase subunit I OS=Rickettsia canadensis (strain McKiel) GN=nuoI PE=3 SV=1 50 209 2.0E-72
sp|Q9A6Y4|NUOI_CAUCR NADH-quinone oxidoreductase subunit I OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=nuoI PE=3 SV=1 40 209 3.0E-72
sp|B8EIM5|NUOI_METSB NADH-quinone oxidoreductase subunit I OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=nuoI PE=3 SV=1 51 209 4.0E-72
sp|B2IHV8|NUOI_BEII9 NADH-quinone oxidoreductase subunit I OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=nuoI PE=3 SV=1 51 209 5.0E-71
sp|Q5HBF8|NUOI_EHRRW NADH-quinone oxidoreductase subunit I OS=Ehrlichia ruminantium (strain Welgevonden) GN=nuoI PE=3 SV=1 65 208 8.0E-71
sp|Q5FHN1|NUOI_EHRRG NADH-quinone oxidoreductase subunit I OS=Ehrlichia ruminantium (strain Gardel) GN=nuoI PE=3 SV=1 65 208 8.0E-71
sp|Q2GCV4|NUOI_NEOSM NADH-quinone oxidoreductase subunit I OS=Neorickettsia sennetsu (strain Miyayama) GN=nuoI PE=3 SV=1 56 202 2.0E-66
sp|Q82TV1|NUOI_NITEU NADH-quinone oxidoreductase subunit I OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=nuoI PE=3 SV=1 51 209 1.0E-65
sp|Q0AHJ2|NUOI_NITEC NADH-quinone oxidoreductase subunit I OS=Nitrosomonas eutropha (strain C91) GN=nuoI PE=3 SV=1 51 209 2.0E-65
sp|Q2YA19|NUOI2_NITMU NADH-quinone oxidoreductase subunit I 2 OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=nuoI2 PE=3 SV=1 51 209 3.0E-63
sp|A2SFN4|NUOI_METPP NADH-quinone oxidoreductase subunit I OS=Methylibium petroleiphilum (strain PM1) GN=nuoI PE=3 SV=1 58 209 4.0E-63
sp|Q142G5|NUOI_BURXL NADH-quinone oxidoreductase subunit I OS=Burkholderia xenovorans (strain LB400) GN=nuoI PE=3 SV=1 56 209 5.0E-63
sp|Q5P1E2|NUOI_AROAE NADH-quinone oxidoreductase subunit I OS=Aromatoleum aromaticum (strain EbN1) GN=nuoI PE=3 SV=1 49 209 6.0E-63
sp|Q2KUZ8|NUOI_BORA1 NADH-quinone oxidoreductase subunit I OS=Bordetella avium (strain 197N) GN=nuoI PE=3 SV=1 58 209 9.0E-63
sp|Q8XXQ9|NUOI_RALSO NADH-quinone oxidoreductase subunit I OS=Ralstonia solanacearum (strain GMI1000) GN=nuoI PE=3 SV=1 50 209 1.0E-62
sp|Q127Y0|NUOI_POLSJ NADH-quinone oxidoreductase subunit I OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=nuoI PE=3 SV=1 58 209 1.0E-62
sp|A1VM68|NUOI_POLNA NADH-quinone oxidoreductase subunit I OS=Polaromonas naphthalenivorans (strain CJ2) GN=nuoI PE=3 SV=1 58 209 2.0E-62
sp|Q7VZP7|NUOI_BORPE NADH-quinone oxidoreductase subunit I OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=nuoI PE=3 SV=1 58 209 2.0E-62
sp|Q7W5B5|NUOI_BORPA NADH-quinone oxidoreductase subunit I OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=nuoI PE=3 SV=2 58 209 2.0E-62
sp|Q7WCU7|NUOI_BORBR NADH-quinone oxidoreductase subunit I OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=nuoI PE=3 SV=1 58 209 2.0E-62
sp|Q7NZH3|NUOI_CHRVO NADH-quinone oxidoreductase subunit I OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=nuoI PE=3 SV=1 56 209 2.0E-62
sp|A1KRT1|NUOI_NEIMF NADH-quinone oxidoreductase subunit I OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=nuoI PE=3 SV=1 51 209 5.0E-62
sp|Q7DDS1|NUOI_NEIMB NADH-quinone oxidoreductase subunit I OS=Neisseria meningitidis serogroup B (strain MC58) GN=nuoI PE=3 SV=1 51 209 5.0E-62
sp|Q9JQM2|NUOI_NEIMA NADH-quinone oxidoreductase subunit I OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=nuoI PE=3 SV=1 51 209 5.0E-62
sp|Q5F623|NUOI_NEIG1 NADH-quinone oxidoreductase subunit I OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=nuoI PE=3 SV=1 51 209 5.0E-62
sp|Q3SJP9|NUOI_THIDA NADH-quinone oxidoreductase subunit I OS=Thiobacillus denitrificans (strain ATCC 25259) GN=nuoI PE=3 SV=1 51 209 8.0E-62
sp|Q0A783|NUOI_ALKEH NADH-quinone oxidoreductase subunit I OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=nuoI PE=3 SV=1 56 209 1.0E-61
sp|Q47HG8|NUOI_DECAR NADH-quinone oxidoreductase subunit I OS=Dechloromonas aromatica (strain RCB) GN=nuoI PE=3 SV=1 49 209 2.0E-61
sp|A1W4N0|NUOI_ACISJ NADH-quinone oxidoreductase subunit I OS=Acidovorax sp. (strain JS42) GN=nuoI PE=3 SV=1 56 209 5.0E-61
sp|Q21YB9|NUOI_RHOFT NADH-quinone oxidoreductase subunit I OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=nuoI PE=3 SV=1 58 209 8.0E-61
sp|A1K5B6|NUOI_AZOSB NADH-quinone oxidoreductase subunit I OS=Azoarcus sp. (strain BH72) GN=nuoI PE=3 SV=1 49 209 9.0E-61
sp|Q473T5|NUOI_CUPPJ NADH-quinone oxidoreductase subunit I OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=nuoI PE=3 SV=1 50 209 1.0E-60
sp|Q31HF2|NUOI_THICR NADH-quinone oxidoreductase subunit I OS=Thiomicrospira crunogena (strain XCL-2) GN=nuoI PE=3 SV=1 56 209 2.0E-60
sp|A1WXV9|NUOI_HALHL NADH-quinone oxidoreductase subunit I OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=nuoI PE=3 SV=1 58 209 3.0E-60
sp|Q2SZM7|NUOI_BURTA NADH-quinone oxidoreductase subunit I OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=nuoI PE=3 SV=1 51 209 4.0E-60
sp|A4JGC2|NUOI_BURVG NADH-quinone oxidoreductase subunit I OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=nuoI PE=3 SV=1 51 209 4.0E-60
sp|B3R3X5|NUOI_CUPTR NADH-quinone oxidoreductase subunit I OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=nuoI PE=3 SV=1 50 209 6.0E-60
sp|Q0KCS2|NUOI_CUPNH NADH-quinone oxidoreductase subunit I OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=nuoI PE=3 SV=1 50 209 6.0E-60
sp|A9AFZ5|NUOI_BURM1 NADH-quinone oxidoreductase subunit I OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=nuoI PE=3 SV=1 51 209 7.0E-60
sp|Q0BDD8|NUOI_BURCM NADH-quinone oxidoreductase subunit I OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=nuoI PE=3 SV=1 51 209 7.0E-60
sp|B1YTP9|NUOI_BURA4 NADH-quinone oxidoreductase subunit I OS=Burkholderia ambifaria (strain MC40-6) GN=nuoI PE=3 SV=1 51 209 7.0E-60
sp|A0K915|NUOI_BURCH NADH-quinone oxidoreductase subunit I OS=Burkholderia cenocepacia (strain HI2424) GN=nuoI PE=3 SV=1 51 209 2.0E-59
sp|B1JVN3|NUOI_BURCC NADH-quinone oxidoreductase subunit I OS=Burkholderia cenocepacia (strain MC0-3) GN=nuoI PE=3 SV=1 51 209 2.0E-59
sp|Q1BV21|NUOI_BURCA NADH-quinone oxidoreductase subunit I OS=Burkholderia cenocepacia (strain AU 1054) GN=nuoI PE=3 SV=1 51 209 2.0E-59
sp|Q63VM5|NUOI_BURPS NADH-quinone oxidoreductase subunit I OS=Burkholderia pseudomallei (strain K96243) GN=nuoI PE=3 SV=1 51 209 2.0E-59
sp|Q3JUA1|NUOI_BURP1 NADH-quinone oxidoreductase subunit I OS=Burkholderia pseudomallei (strain 1710b) GN=nuoI PE=3 SV=1 51 209 2.0E-59
sp|A3NTB4|NUOI_BURP0 NADH-quinone oxidoreductase subunit I OS=Burkholderia pseudomallei (strain 1106a) GN=nuoI PE=3 SV=1 51 209 2.0E-59
sp|A1V2M4|NUOI_BURMS NADH-quinone oxidoreductase subunit I OS=Burkholderia mallei (strain SAVP1) GN=nuoI PE=3 SV=1 51 209 2.0E-59
sp|Q62IP3|NUOI_BURMA NADH-quinone oxidoreductase subunit I OS=Burkholderia mallei (strain ATCC 23344) GN=nuoI PE=3 SV=1 51 209 2.0E-59
sp|A2S451|NUOI_BURM9 NADH-quinone oxidoreductase subunit I OS=Burkholderia mallei (strain NCTC 10229) GN=nuoI PE=3 SV=1 51 209 2.0E-59
sp|A3MIA9|NUOI_BURM7 NADH-quinone oxidoreductase subunit I OS=Burkholderia mallei (strain NCTC 10247) GN=nuoI PE=3 SV=1 51 209 2.0E-59
sp|A4G636|NUOI_HERAR NADH-quinone oxidoreductase subunit I OS=Herminiimonas arsenicoxydans GN=nuoI PE=3 SV=1 51 209 3.0E-59
sp|A3N7M5|NUOI_BURP6 NADH-quinone oxidoreductase subunit I OS=Burkholderia pseudomallei (strain 668) GN=nuoI PE=3 SV=1 51 209 3.0E-59
sp|Q1GZL7|NUOI_METFK NADH-quinone oxidoreductase subunit I OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=nuoI PE=3 SV=1 58 209 4.0E-59
sp|B4E5L4|NUOI_BURCJ NADH-quinone oxidoreductase subunit I OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=nuoI PE=3 SV=1 51 209 5.0E-59
sp|Q39EF3|NUOI_BURL3 NADH-quinone oxidoreductase subunit I OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=nuoI PE=3 SV=1 51 209 7.0E-59
sp|Q1LPV5|NUOI_CUPMC NADH-quinone oxidoreductase subunit I OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=nuoI PE=3 SV=1 50 209 6.0E-58
sp|Q3J836|NUOI2_NITOC NADH-quinone oxidoreductase subunit I 2 OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=nuoI2 PE=3 SV=1 74 209 1.0E-57
sp|Q87EP7|NUOI_XYLFT NADH-quinone oxidoreductase subunit I OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=nuoI PE=3 SV=1 71 209 1.0E-57
sp|Q9PGI7|NUOI_XYLFA NADH-quinone oxidoreductase subunit I OS=Xylella fastidiosa (strain 9a5c) GN=nuoI PE=3 SV=1 71 209 1.0E-57
sp|Q8P7U0|NUOI_XANCP NADH-quinone oxidoreductase subunit I OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=nuoI PE=3 SV=1 75 209 3.0E-57
sp|Q4UWB0|NUOI_XANC8 NADH-quinone oxidoreductase subunit I OS=Xanthomonas campestris pv. campestris (strain 8004) GN=nuoI PE=3 SV=1 75 209 3.0E-57
sp|Q3BRN7|NUOI_XANC5 NADH-quinone oxidoreductase subunit I OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=nuoI PE=3 SV=1 75 209 3.0E-57
sp|Q8PJ48|NUOI_XANAC NADH-quinone oxidoreductase subunit I OS=Xanthomonas axonopodis pv. citri (strain 306) GN=nuoI PE=3 SV=1 75 209 3.0E-57
sp|Q5GXU0|NUOI_XANOR NADH-quinone oxidoreductase subunit I OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=nuoI PE=3 SV=1 75 209 3.0E-57
sp|A1WLN6|NUOI_VEREI NADH-quinone oxidoreductase subunit I OS=Verminephrobacter eiseniae (strain EF01-2) GN=nuoI PE=3 SV=1 59 209 3.0E-57
sp|Q2P0W3|NUOI_XANOM NADH-quinone oxidoreductase subunit I OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=nuoI PE=3 SV=1 75 209 3.0E-57
sp|A5CXG5|NUOI_VESOH NADH-quinone oxidoreductase subunit I OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=nuoI PE=3 SV=1 51 209 9.0E-57
sp|A1TLM4|NUOI_ACIAC NADH-quinone oxidoreductase subunit I OS=Acidovorax citrulli (strain AAC00-1) GN=nuoI PE=3 SV=1 59 194 1.0E-56
sp|B0TWQ2|NUOI_FRAP2 NADH-quinone oxidoreductase subunit I OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=nuoI PE=3 SV=1 56 209 2.0E-56
sp|A1AVS0|NUOI_RUTMC NADH-quinone oxidoreductase subunit I OS=Ruthia magnifica subsp. Calyptogena magnifica GN=nuoI PE=3 SV=1 51 209 3.0E-56
sp|A0Q8G4|NUOI_FRATN NADH-quinone oxidoreductase subunit I OS=Francisella tularensis subsp. novicida (strain U112) GN=nuoI PE=3 SV=1 56 209 1.0E-55
sp|A7NEK2|NUOI_FRATF NADH-quinone oxidoreductase subunit I OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=nuoI PE=3 SV=1 56 209 1.0E-55
sp|A4IW00|NUOI_FRATW NADH-quinone oxidoreductase subunit I OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=nuoI PE=3 SV=1 56 209 4.0E-55
sp|Q5NIM7|NUOI_FRATT NADH-quinone oxidoreductase subunit I OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=nuoI PE=3 SV=1 56 209 4.0E-55
sp|Q0BK59|NUOI_FRATO NADH-quinone oxidoreductase subunit I OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=nuoI PE=3 SV=1 56 209 4.0E-55
sp|B2SEV7|NUOI_FRATM NADH-quinone oxidoreductase subunit I OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=nuoI PE=3 SV=1 56 209 4.0E-55
sp|Q2A1F8|NUOI_FRATH NADH-quinone oxidoreductase subunit I OS=Francisella tularensis subsp. holarctica (strain LVS) GN=nuoI PE=3 SV=1 56 209 4.0E-55
sp|Q14K30|NUOI_FRAT1 NADH-quinone oxidoreductase subunit I OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=nuoI PE=3 SV=1 56 209 4.0E-55
sp|Q5WT28|NUOI_LEGPL NADH-quinone oxidoreductase subunit I OS=Legionella pneumophila (strain Lens) GN=nuoI PE=3 SV=1 71 209 1.0E-54
sp|Q5ZRU6|NUOI_LEGPH NADH-quinone oxidoreductase subunit I OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=nuoI PE=3 SV=1 71 209 1.0E-54
sp|A5IHV5|NUOI_LEGPC NADH-quinone oxidoreductase subunit I OS=Legionella pneumophila (strain Corby) GN=nuoI PE=3 SV=1 71 209 1.0E-54
sp|Q5X1B5|NUOI_LEGPA NADH-quinone oxidoreductase subunit I OS=Legionella pneumophila (strain Paris) GN=nuoI PE=3 SV=1 71 209 1.0E-54
sp|Q83BR3|NUOI_COXBU NADH-quinone oxidoreductase subunit I OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=nuoI PE=3 SV=1 51 209 3.0E-53
sp|A9N8W4|NUOI_COXBR NADH-quinone oxidoreductase subunit I OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=nuoI PE=3 SV=1 51 209 3.0E-53
sp|A9KBL3|NUOI_COXBN NADH-quinone oxidoreductase subunit I OS=Coxiella burnetii (strain Dugway 5J108-111) GN=nuoI PE=3 SV=1 51 209 3.0E-53
sp|A0LDR9|NUOI_MAGMM NADH-quinone oxidoreductase subunit I OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=nuoI PE=3 SV=1 51 209 1.0E-52
sp|Q67P14|NUOI1_SYMTH NADH-quinone oxidoreductase subunit I 1 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=nuoI1 PE=3 SV=1 60 189 9.0E-34
sp|Q1IZW5|NUOI_DEIGD NADH-quinone oxidoreductase subunit I OS=Deinococcus geothermalis (strain DSM 11300) GN=nuoI PE=3 SV=1 60 209 1.0E-31
sp|Q9RU95|NUOI_DEIRA NADH-quinone oxidoreductase subunit I OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=nuoI PE=3 SV=1 60 209 2.0E-31
sp|Q74GA0|NUOI1_GEOSL NADH-quinone oxidoreductase subunit I 1 OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=nuoI1 PE=3 SV=1 59 188 8.0E-31
sp|C1D0H9|NUOI_DEIDV NADH-quinone oxidoreductase subunit I OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=nuoI PE=3 SV=1 60 188 8.0E-31
sp|C4LB38|NUOI_TOLAT NADH-quinone oxidoreductase subunit I OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=nuoI PE=3 SV=1 65 197 1.0E-30
sp|Q39QB5|NUOI2_GEOMG NADH-quinone oxidoreductase subunit I 2 OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=nuoI2 PE=3 SV=1 59 188 1.0E-29
sp|B1KJV5|NUOI_SHEWM NADH-quinone oxidoreductase subunit I OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=nuoI PE=3 SV=1 60 191 1.0E-29
sp|Q6MDQ8|NUOI_PARUW NADH-quinone oxidoreductase subunit I OS=Protochlamydia amoebophila (strain UWE25) GN=nuoI PE=3 SV=2 63 187 2.0E-29
sp|Q2YA98|NUOI1_NITMU NADH-quinone oxidoreductase subunit I 1 OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=nuoI1 PE=3 SV=1 60 191 2.0E-29
sp|Q3A820|NUOI_PELCD NADH-quinone oxidoreductase subunit I OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=nuoI PE=3 SV=1 67 191 4.0E-29
sp|Q3JC22|NUOI1_NITOC NADH-quinone oxidoreductase subunit I 1 OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=nuoI1 PE=3 SV=1 50 197 1.0E-28
sp|Q72GD6|NUOI_THET2 NADH-quinone oxidoreductase subunit I OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=nuoI PE=3 SV=1 60 209 6.0E-28
sp|Q56224|NQO9_THET8 NADH-quinone oxidoreductase subunit 9 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=nqo9 PE=1 SV=1 60 209 6.0E-28
sp|Q744Z4|NUOI1_MYCPA NADH-quinone oxidoreductase subunit I 1 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=nuoI1 PE=3 SV=1 57 188 6.0E-28
sp|Q87ZQ2|NUOI_PSESM NADH-quinone oxidoreductase subunit I OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=nuoI PE=3 SV=1 65 197 7.0E-28
sp|A6H1Q5|NUOI_FLAPJ NADH-quinone oxidoreductase subunit I OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=nuoI PE=3 SV=1 60 188 7.0E-28
sp|Q4ZRI6|NUOI_PSEU2 NADH-quinone oxidoreductase subunit I OS=Pseudomonas syringae pv. syringae (strain B728a) GN=nuoI PE=3 SV=1 65 197 8.0E-28
sp|Q746T4|NUOI2_GEOSL NADH-quinone oxidoreductase subunit I 2 OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=nuoI2 PE=3 SV=1 63 191 8.0E-28
sp|B5Z8R3|NUOI_HELPG NADH-quinone oxidoreductase subunit I OS=Helicobacter pylori (strain G27) GN=nuoI PE=3 SV=1 56 192 1.0E-27
sp|Q1CRZ3|NUOI_HELPH NADH-quinone oxidoreductase subunit I OS=Helicobacter pylori (strain HPAG1) GN=nuoI PE=3 SV=1 56 192 1.0E-27
sp|A3PKI7|NUOI2_RHOS1 NADH-quinone oxidoreductase subunit I 2 OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=nuoI2 PE=3 SV=1 74 196 1.0E-27
sp|Q3J1Q2|NUOI2_RHOS4 NADH-quinone oxidoreductase subunit I 2 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=nuoI2 PE=3 SV=1 74 196 1.0E-27
sp|Q608Y4|NUOI_METCA NADH-quinone oxidoreductase subunit I OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=nuoI PE=3 SV=1 60 191 1.0E-27
sp|Q7MA42|NUOI_WOLSU NADH-quinone oxidoreductase subunit I OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=nuoI PE=3 SV=1 62 201 1.0E-27
sp|Q1QST9|NUOI_CHRSD NADH-quinone oxidoreductase subunit I OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=nuoI PE=3 SV=1 65 191 2.0E-27
sp|A0QU28|NUOI_MYCS2 NADH-quinone oxidoreductase subunit I OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=nuoI PE=3 SV=1 66 188 2.0E-27
sp|Q48H47|NUOI_PSE14 NADH-quinone oxidoreductase subunit I OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=nuoI PE=3 SV=1 65 197 2.0E-27
sp|Q8RQ74|NUOI_PSEFL NADH-quinone oxidoreductase subunit I OS=Pseudomonas fluorescens GN=nuoI PE=2 SV=1 65 197 2.0E-27
sp|Q3KA56|NUOI_PSEPF NADH-quinone oxidoreductase subunit I OS=Pseudomonas fluorescens (strain Pf0-1) GN=nuoI PE=3 SV=1 65 197 2.0E-27
sp|Q39ZB4|NUOI1_GEOMG NADH-quinone oxidoreductase subunit I 1 OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=nuoI1 PE=3 SV=2 63 196 3.0E-27
sp|Q1BBQ1|NUOI_MYCSS NADH-quinone oxidoreductase subunit I OS=Mycobacterium sp. (strain MCS) GN=nuoI PE=3 SV=1 60 188 3.0E-27
sp|A1UD96|NUOI_MYCSK NADH-quinone oxidoreductase subunit I OS=Mycobacterium sp. (strain KMS) GN=nuoI PE=3 SV=1 60 188 3.0E-27
sp|A3PWR3|NUOI_MYCSJ NADH-quinone oxidoreductase subunit I OS=Mycobacterium sp. (strain JLS) GN=nuoI PE=3 SV=1 60 188 3.0E-27
sp|Q7VFT0|NUOI_HELHP NADH-quinone oxidoreductase subunit I OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=nuoI PE=3 SV=1 62 191 4.0E-27
sp|P57259|NUOI_BUCAI NADH-quinone oxidoreductase subunit I OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=nuoI PE=3 SV=1 65 191 5.0E-27
sp|Q1I7Z3|NUOI_PSEE4 NADH-quinone oxidoreductase subunit I OS=Pseudomonas entomophila (strain L48) GN=nuoI PE=3 SV=1 65 197 5.0E-27
sp|Q47LF2|NUOI_THEFY NADH-quinone oxidoreductase subunit I OS=Thermobifida fusca (strain YX) GN=nuoI PE=3 SV=1 64 188 6.0E-27
sp|Q4K9S9|NUOI_PSEF5 NADH-quinone oxidoreductase subunit I OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=nuoI PE=3 SV=1 65 197 6.0E-27
sp|Q9ZJV9|NUOI_HELPJ NADH-quinone oxidoreductase subunit I OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=nuoI PE=3 SV=1 56 192 7.0E-27
sp|B6JNA8|NUOI_HELP2 NADH-quinone oxidoreductase subunit I OS=Helicobacter pylori (strain P12) GN=nuoI PE=3 SV=1 56 192 8.0E-27
sp|Q88FH0|NUOI_PSEPK NADH-quinone oxidoreductase subunit I OS=Pseudomonas putida (strain KT2440) GN=nuoI PE=3 SV=1 65 197 8.0E-27
sp|Q4FU57|NUOI_PSYA2 NADH-quinone oxidoreductase subunit I OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=nuoI PE=3 SV=1 63 197 8.0E-27
sp|B2UV32|NUOI_HELPS NADH-quinone oxidoreductase subunit I OS=Helicobacter pylori (strain Shi470) GN=nuoI PE=3 SV=1 56 192 9.0E-27
sp|Q1QD90|NUOI_PSYCK NADH-quinone oxidoreductase subunit I OS=Psychrobacter cryohalolentis (strain K5) GN=nuoI PE=3 SV=1 63 197 9.0E-27
sp|Q1IQK4|NUOI2_KORVE NADH-quinone oxidoreductase subunit I 2 OS=Koribacter versatilis (strain Ellin345) GN=nuoI2 PE=3 SV=1 54 189 9.0E-27
sp|A8LC93|NUOI_FRASN NADH-quinone oxidoreductase subunit I OS=Frankia sp. (strain EAN1pec) GN=nuoI PE=3 SV=1 65 188 9.0E-27
sp|O25858|NUOI_HELPY NADH-quinone oxidoreductase subunit I OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=nuoI PE=3 SV=1 56 192 1.0E-26
sp|A1T698|NUOI_MYCVP NADH-quinone oxidoreductase subunit I OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=nuoI PE=3 SV=1 66 207 1.0E-26
sp|A0LRI9|NUOI_ACIC1 NADH-quinone oxidoreductase subunit I OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=nuoI PE=3 SV=1 65 188 1.0E-26
sp|A0PR46|NUOI_MYCUA NADH-quinone oxidoreductase subunit I OS=Mycobacterium ulcerans (strain Agy99) GN=nuoI PE=3 SV=1 66 200 1.0E-26
sp|B2HGE0|NUOI_MYCMM NADH-quinone oxidoreductase subunit I OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=nuoI PE=3 SV=1 66 200 1.0E-26
sp|Q17Z60|NUOI_HELAH NADH-quinone oxidoreductase subunit I OS=Helicobacter acinonychis (strain Sheeba) GN=nuoI PE=3 SV=1 56 192 1.0E-26
sp|Q2JFL2|NUOI_FRASC NADH-quinone oxidoreductase subunit I OS=Frankia sp. (strain CcI3) GN=nuoI PE=3 SV=1 65 188 1.0E-26
sp|A4SLN7|NUOI_AERS4 NADH-quinone oxidoreductase subunit I OS=Aeromonas salmonicida (strain A449) GN=nuoI PE=3 SV=1 65 197 2.0E-26
sp|Q8EI36|NUOI_SHEON NADH-quinone oxidoreductase subunit I OS=Shewanella oneidensis (strain MR-1) GN=nuoI PE=3 SV=1 65 191 3.0E-26
sp|B1JGM0|NUOI_YERPY NADH-quinone oxidoreductase subunit I OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=nuoI PE=3 SV=1 64 197 3.0E-26
sp|Q669A7|NUOI_YERPS NADH-quinone oxidoreductase subunit I OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=nuoI PE=3 SV=1 64 197 3.0E-26
sp|A4TM29|NUOI_YERPP NADH-quinone oxidoreductase subunit I OS=Yersinia pestis (strain Pestoides F) GN=nuoI PE=3 SV=1 64 197 3.0E-26
sp|Q1CHQ8|NUOI_YERPN NADH-quinone oxidoreductase subunit I OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=nuoI PE=3 SV=1 64 197 3.0E-26
sp|A9R6L4|NUOI_YERPG NADH-quinone oxidoreductase subunit I OS=Yersinia pestis bv. Antiqua (strain Angola) GN=nuoI PE=3 SV=1 64 197 3.0E-26
sp|Q7CJ89|NUOI_YERPE NADH-quinone oxidoreductase subunit I OS=Yersinia pestis GN=nuoI PE=3 SV=1 64 197 3.0E-26
sp|B2K814|NUOI_YERPB NADH-quinone oxidoreductase subunit I OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=nuoI PE=3 SV=1 64 197 3.0E-26
sp|Q1C6B6|NUOI_YERPA NADH-quinone oxidoreductase subunit I OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=nuoI PE=3 SV=1 64 197 3.0E-26
sp|A7FGR1|NUOI_YERP3 NADH-quinone oxidoreductase subunit I OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=nuoI PE=3 SV=1 64 197 3.0E-26
sp|Q057W8|NUOI_BUCCC NADH-quinone oxidoreductase subunit I OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=nuoI PE=3 SV=1 57 191 4.0E-26
sp|A4TDB3|NUOI_MYCGI NADH-quinone oxidoreductase subunit I OS=Mycobacterium gilvum (strain PYR-GCK) GN=nuoI PE=3 SV=1 66 207 4.0E-26
sp|B4EZC3|NUOI_PROMH NADH-quinone oxidoreductase subunit I OS=Proteus mirabilis (strain HI4320) GN=nuoI PE=3 SV=1 64 197 5.0E-26
sp|A7HZV6|NUOI_CAMHC NADH-quinone oxidoreductase subunit I OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=nuoI PE=3 SV=1 40 187 5.0E-26
sp|B2VIN2|NUOI_ERWT9 NADH-quinone oxidoreductase subunit I OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=nuoI PE=3 SV=1 64 197 5.0E-26
sp|Q9I0J4|NUOI_PSEAE NADH-quinone oxidoreductase subunit I OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=nuoI PE=3 SV=1 65 197 7.0E-26
sp|Q02ND6|NUOI_PSEAB NADH-quinone oxidoreductase subunit I OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=nuoI PE=3 SV=1 65 197 7.0E-26
sp|B7VAQ8|NUOI_PSEA8 NADH-quinone oxidoreductase subunit I OS=Pseudomonas aeruginosa (strain LESB58) GN=nuoI PE=3 SV=1 65 197 7.0E-26
sp|A6V4E1|NUOI_PSEA7 NADH-quinone oxidoreductase subunit I OS=Pseudomonas aeruginosa (strain PA7) GN=nuoI PE=3 SV=1 65 197 7.0E-26
sp|B0V894|NUOI_ACIBY NADH-quinone oxidoreductase subunit I OS=Acinetobacter baumannii (strain AYE) GN=nuoI PE=3 SV=1 60 197 8.0E-26
sp|A3M2Q5|NUOI_ACIBT NADH-quinone oxidoreductase subunit I OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=nuoI PE=3 SV=2 60 197 8.0E-26
sp|B0VU49|NUOI_ACIBS NADH-quinone oxidoreductase subunit I OS=Acinetobacter baumannii (strain SDF) GN=nuoI PE=3 SV=1 60 197 8.0E-26
sp|B2HU48|NUOI_ACIBC NADH-quinone oxidoreductase subunit I OS=Acinetobacter baumannii (strain ACICU) GN=nuoI PE=3 SV=1 60 197 8.0E-26
sp|A0QJV5|NUOI_MYCA1 NADH-quinone oxidoreductase subunit I OS=Mycobacterium avium (strain 104) GN=nuoI PE=3 SV=1 54 188 9.0E-26
sp|Q73V07|NUOI2_MYCPA NADH-quinone oxidoreductase subunit I 2 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=nuoI2 PE=3 SV=1 54 188 9.0E-26
sp|Q8K9Y0|NUOI_BUCAP NADH-quinone oxidoreductase subunit I OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=nuoI PE=3 SV=1 65 191 1.0E-25
sp|A0KJ60|NUOI_AERHH NADH-quinone oxidoreductase subunit I OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=nuoI PE=3 SV=1 65 197 1.0E-25
sp|Q0RRW0|NUOI_FRAAA NADH-quinone oxidoreductase subunit I OS=Frankia alni (strain ACN14a) GN=nuoI PE=3 SV=1 65 188 1.0E-25
sp|A0LJM3|NUOI2_SYNFM NADH-quinone oxidoreductase subunit I 2 OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=nuoI2 PE=3 SV=1 63 190 2.0E-25
sp|A1JLI2|NUOI_YERE8 NADH-quinone oxidoreductase subunit I OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=nuoI PE=3 SV=1 64 197 2.0E-25
sp|B0SRH5|NUOI_LEPBP NADH-quinone oxidoreductase subunit I OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=nuoI PE=3 SV=1 58 188 2.0E-25
sp|B0SHV5|NUOI_LEPBA NADH-quinone oxidoreductase subunit I OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=nuoI PE=3 SV=1 58 188 2.0E-25
sp|Q7N2J4|NUOI_PHOLL NADH-quinone oxidoreductase subunit I OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=nuoI PE=3 SV=1 64 191 3.0E-25
sp|A1SE35|NUOI_NOCSJ NADH-quinone oxidoreductase subunit I OS=Nocardioides sp. (strain BAA-499 / JS614) GN=nuoI PE=3 SV=1 66 188 3.0E-25
sp|Q6FE64|NUOI_ACIAD NADH-quinone oxidoreductase subunit I OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=nuoI PE=3 SV=1 63 197 3.0E-25
sp|Q11VC0|NUOI_CYTH3 NADH-quinone oxidoreductase subunit I OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=nuoI PE=3 SV=1 63 189 4.0E-25
sp|Q01ZR8|NUOI1_SOLUE NADH-quinone oxidoreductase subunit I 1 OS=Solibacter usitatus (strain Ellin6076) GN=nuoI1 PE=3 SV=1 63 188 5.0E-25
sp|C1AZF5|NUOI_RHOOB NADH-quinone oxidoreductase subunit I OS=Rhodococcus opacus (strain B4) GN=nuoI PE=3 SV=1 66 188 5.0E-25
sp|C1AGS0|NUOI_MYCBT NADH-quinone oxidoreductase subunit I OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=nuoI PE=3 SV=1 60 207 6.0E-25
sp|A1KNE9|NUOI_MYCBP NADH-quinone oxidoreductase subunit I OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=nuoI PE=3 SV=1 60 207 6.0E-25
sp|Q7TX57|NUOI_MYCBO NADH-quinone oxidoreductase subunit I OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=nuoI PE=3 SV=1 60 207 6.0E-25
sp|Q0S442|NUOI_RHOJR NADH-quinone oxidoreductase subunit I OS=Rhodococcus jostii (strain RHA1) GN=nuoI PE=3 SV=1 66 188 6.0E-25
sp|Q92YN8|NUOI2_RHIME NADH-quinone oxidoreductase subunit I 2 OS=Rhizobium meliloti (strain 1021) GN=nuoI2 PE=3 SV=1 51 188 7.0E-25
sp|Q04W38|NUOI_LEPBJ NADH-quinone oxidoreductase subunit I OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=nuoI PE=3 SV=1 58 189 7.0E-25
sp|Q7CQ51|NUOI_SALTY NADH-quinone oxidoreductase subunit I OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=nuoI PE=3 SV=1 64 197 9.0E-25
sp|Q8XFD5|NUOI_SALTI NADH-quinone oxidoreductase subunit I OS=Salmonella typhi GN=nuoI PE=3 SV=1 64 197 9.0E-25
sp|Q5PN58|NUOI_SALPA NADH-quinone oxidoreductase subunit I OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=nuoI PE=3 SV=1 64 197 9.0E-25
sp|Q57M35|NUOI_SALCH NADH-quinone oxidoreductase subunit I OS=Salmonella choleraesuis (strain SC-B67) GN=nuoI PE=3 SV=1 64 197 9.0E-25
sp|P9WJG9|NUOI_MYCTU NADH-quinone oxidoreductase subunit I OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=nuoI PE=1 SV=1 60 200 9.0E-25
sp|P9WJG8|NUOI_MYCTO NADH-quinone oxidoreductase subunit I OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=nuoI PE=3 SV=1 60 200 9.0E-25
sp|A5U7G9|NUOI_MYCTA NADH-quinone oxidoreductase subunit I OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=nuoI PE=3 SV=1 60 200 9.0E-25
sp|P0AFD9|NUOI_SHIFL NADH-quinone oxidoreductase subunit I OS=Shigella flexneri GN=nuoI PE=3 SV=1 64 197 1.0E-24
sp|Q0T2K6|NUOI_SHIF8 NADH-quinone oxidoreductase subunit I OS=Shigella flexneri serotype 5b (strain 8401) GN=nuoI PE=3 SV=1 64 197 1.0E-24
sp|Q32DQ8|NUOI_SHIDS NADH-quinone oxidoreductase subunit I OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=nuoI PE=3 SV=1 64 197 1.0E-24
sp|Q31YI0|NUOI_SHIBS NADH-quinone oxidoreductase subunit I OS=Shigella boydii serotype 4 (strain Sb227) GN=nuoI PE=3 SV=1 64 197 1.0E-24
sp|Q1R9D6|NUOI_ECOUT NADH-quinone oxidoreductase subunit I OS=Escherichia coli (strain UTI89 / UPEC) GN=nuoI PE=3 SV=1 64 197 1.0E-24
sp|P0AFD6|NUOI_ECOLI NADH-quinone oxidoreductase subunit I OS=Escherichia coli (strain K12) GN=nuoI PE=1 SV=1 64 197 1.0E-24
sp|P0AFD7|NUOI_ECOL6 NADH-quinone oxidoreductase subunit I OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=nuoI PE=3 SV=1 64 197 1.0E-24
sp|Q0TFG5|NUOI_ECOL5 NADH-quinone oxidoreductase subunit I OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=nuoI PE=3 SV=1 64 197 1.0E-24
sp|A1ADC9|NUOI_ECOK1 NADH-quinone oxidoreductase subunit I OS=Escherichia coli O1:K1 / APEC GN=nuoI PE=3 SV=1 64 197 1.0E-24
sp|P0AFD8|NUOI_ECO57 NADH-quinone oxidoreductase subunit I OS=Escherichia coli O157:H7 GN=nuoI PE=3 SV=1 64 197 1.0E-24
sp|Q04XD4|NUOI_LEPBL NADH-quinone oxidoreductase subunit I OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=nuoI PE=3 SV=1 58 189 1.0E-24
sp|Q8F9N0|NUOI_LEPIN NADH-quinone oxidoreductase subunit I OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=nuoI PE=3 SV=1 58 189 1.0E-24
sp|Q72VZ9|NUOI_LEPIC NADH-quinone oxidoreductase subunit I OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=nuoI PE=3 SV=1 58 189 1.0E-24
sp|Q6D2S4|NUOI_PECAS NADH-quinone oxidoreductase subunit I OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=nuoI PE=3 SV=1 65 197 1.0E-24
sp|Q3YZS9|NUOI_SHISS NADH-quinone oxidoreductase subunit I OS=Shigella sonnei (strain Ss046) GN=nuoI PE=3 SV=1 64 197 1.0E-24
sp|A7MPB5|NUOI_CROS8 NADH-quinone oxidoreductase subunit I OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=nuoI PE=3 SV=1 65 197 2.0E-24
sp|Q5HSM0|NUOI_CAMJR NADH-quinone oxidoreductase subunit I OS=Campylobacter jejuni (strain RM1221) GN=nuoI PE=3 SV=1 62 206 2.0E-24
sp|A1W1H0|NUOI_CAMJJ NADH-quinone oxidoreductase subunit I OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=nuoI PE=3 SV=1 62 206 2.0E-24
sp|Q0P857|NUOI_CAMJE NADH-quinone oxidoreductase subunit I OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=nuoI PE=3 SV=1 62 206 2.0E-24
sp|Q30PI7|NUOI_SULDN NADH-quinone oxidoreductase subunit I OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=nuoI PE=3 SV=1 62 187 2.0E-24
sp|A8FNM9|NUOI_CAMJ8 NADH-quinone oxidoreductase subunit I OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=nuoI PE=3 SV=1 62 206 3.0E-24
sp|Q5YWD4|NUOHI_NOCFA NADH-quinone oxidoreductase subunits H/I OS=Nocardia farcinica (strain IFM 10152) GN=nuoH/I PE=3 SV=1 60 188 3.0E-24
sp|Q2NSK6|NUOI_SODGM NADH-quinone oxidoreductase subunit I OS=Sodalis glossinidius (strain morsitans) GN=nuoI PE=3 SV=1 65 197 3.0E-24
sp|A7H5S3|NUOI_CAMJD NADH-quinone oxidoreductase subunit I OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=nuoI PE=3 SV=1 62 206 3.0E-24
sp|Q82DX3|NUOI1_STRAW NADH-quinone oxidoreductase subunit I 1 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=nuoI1 PE=3 SV=1 66 192 5.0E-24
sp|Q2J0E6|NUOI1_RHOP2 NADH-quinone oxidoreductase subunit I 1 OS=Rhodopseudomonas palustris (strain HaA2) GN=nuoI1 PE=3 SV=1 54 192 7.0E-24
sp|Q13BG8|NUOI1_RHOPS NADH-quinone oxidoreductase subunit I 1 OS=Rhodopseudomonas palustris (strain BisB5) GN=nuoI1 PE=3 SV=1 54 192 7.0E-24
sp|C0ZYJ2|NUOI_RHOE4 NADH-quinone oxidoreductase subunit I OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=nuoI PE=3 SV=1 66 188 8.0E-24
sp|Q2K3T7|NUOI2_RHIEC NADH-quinone oxidoreductase subunit I 2 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=nuoI2 PE=3 SV=1 52 188 1.0E-23
sp|Q9XAR2|NUOI1_STRCO NADH-quinone oxidoreductase subunit I 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=nuoI1 PE=3 SV=1 66 188 2.0E-23
sp|Q6N1Z5|NUOI2_RHOPA NADH-quinone oxidoreductase subunit I 2 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=nuoI2 PE=3 SV=1 73 192 3.0E-23
sp|C5B8H9|NUOI_EDWI9 NADH-quinone oxidoreductase subunit I OS=Edwardsiella ictaluri (strain 93-146) GN=nuoI PE=3 SV=1 64 197 4.0E-23
sp|Q492I3|NUOI_BLOPB NADH-quinone oxidoreductase subunit I OS=Blochmannia pennsylvanicus (strain BPEN) GN=nuoI PE=3 SV=1 53 191 5.0E-23
sp|Q6A6G6|NUOI_PROAC NADH-quinone oxidoreductase subunit I OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=nuoI PE=3 SV=1 66 188 2.0E-22
sp|Q6MIR9|NUOI_BDEBA NADH-quinone oxidoreductase subunit I OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=nuoI PE=3 SV=1 56 187 2.0E-22
sp|A4FPT3|NUOI_SACEN NADH-quinone oxidoreductase subunit I OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=nuoI PE=3 SV=1 65 188 4.0E-22
sp|Q7VRV9|NUOI_BLOFL NADH-quinone oxidoreductase subunit I OS=Blochmannia floridanus GN=nuoI PE=3 SV=1 53 191 4.0E-22
sp|Q20Z46|NUOI2_RHOPB NADH-quinone oxidoreductase subunit I 2 OS=Rhodopseudomonas palustris (strain BisB18) GN=nuoI2 PE=3 SV=1 80 192 5.0E-22
sp|Q07QW8|NUOI1_RHOP5 NADH-quinone oxidoreductase subunit I 1 OS=Rhodopseudomonas palustris (strain BisA53) GN=nuoI1 PE=3 SV=1 66 192 8.0E-22
sp|B3QSE2|NUOI_CHLT3 NADH-quinone oxidoreductase subunit I OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=nuoI PE=3 SV=1 51 188 1.0E-21
sp|Q1LT96|NUOI_BAUCH NADH-quinone oxidoreductase subunit I OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=nuoI PE=3 SV=1 63 197 2.0E-21
sp|Q89AT9|NUOI_BUCBP NADH-quinone oxidoreductase subunit I OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=nuoI PE=3 SV=1 54 191 2.0E-21
sp|A0LEQ3|NUOI1_SYNFM NADH-quinone oxidoreductase subunit I 1 OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=nuoI1 PE=3 SV=1 63 177 1.0E-20
sp|Q67KP1|NUOI2_SYMTH NADH-quinone oxidoreductase subunit I 2 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=nuoI2 PE=3 SV=1 72 194 3.0E-19
sp|Q3AC82|NUOI_CARHZ NADH-quinone oxidoreductase subunit I OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=nuoI PE=3 SV=1 61 187 3.0E-19
sp|P30826|NDUS8_TRYBB NADH-ubiquinone oxidoreductase subunit 8 OS=Trypanosoma brucei brucei GN=M-ISP1 PE=2 SV=1 75 167 5.0E-19
sp|Q01UN8|NUOI2_SOLUE NADH-quinone oxidoreductase subunit I 2 OS=Solibacter usitatus (strain Ellin6076) GN=nuoI2 PE=3 SV=1 50 187 2.0E-18
sp|Q2IL01|NUOI1_ANADE NADH-quinone oxidoreductase subunit I 1 OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=nuoI1 PE=3 SV=1 80 190 2.0E-18
sp|Q4QSC5|NQO9_RHOMR NADH-quinone oxidoreductase subunit 9 OS=Rhodothermus marinus GN=nqo9 PE=3 SV=1 63 207 3.0E-18
sp|O67386|NUOI2_AQUAE NADH-quinone oxidoreductase subunit I 2 OS=Aquifex aeolicus (strain VF5) GN=nuoI2 PE=3 SV=1 51 195 2.0E-17
sp|A4QJQ4|NDHI_AETGR NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Aethionema grandiflorum GN=ndhI PE=3 SV=1 63 187 2.0E-17
sp|A7H9V8|NUOI_ANADF NADH-quinone oxidoreductase subunit I OS=Anaeromyxobacter sp. (strain Fw109-5) GN=nuoI PE=3 SV=1 80 190 2.0E-17
sp|A1E9X8|NDHI_SORBI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Sorghum bicolor GN=ndhI PE=3 SV=1 63 187 2.0E-17
sp|Q6ENP3|NDHI_SACOF NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Saccharum officinarum GN=ndhI PE=3 SV=1 63 187 2.0E-17
sp|Q6L3D6|NDHI_SACHY NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Saccharum hybrid GN=ndhI PE=3 SV=1 63 187 2.0E-17
sp|O67337|NUOI1_AQUAE NADH-quinone oxidoreductase subunit I OS=Aquifex aeolicus (strain VF5) GN=nuoI PE=3 SV=1 58 187 3.0E-17
sp|Q8HVU7|NDHI_CHASO NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Chamaechaenactis scaposa GN=ndhI PE=3 SV=1 63 187 4.0E-17
sp|A4QK74|NDHI_ARAHI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Arabis hirsuta GN=ndhI PE=3 SV=1 63 187 4.0E-17
sp|A4QL75|NDHI_DRANE NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Draba nemorosa GN=ndhI PE=3 SV=1 63 187 1.0E-16
sp|Q8HVR5|NDHI_HULAL NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Hulsea algida GN=ndhI PE=3 SV=1 63 187 1.0E-16
sp|A4QLQ1|NDHI_LOBMA NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Lobularia maritima GN=ndhI PE=3 SV=1 63 187 1.0E-16
sp|Q1D8T0|NUOI_MYXXD NADH-quinone oxidoreductase subunit I OS=Myxococcus xanthus (strain DK 1622) GN=nuoI PE=3 SV=1 41 196 1.0E-16
sp|P56755|NDHI_ARATH NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Arabidopsis thaliana GN=ndhI PE=3 SV=1 63 187 1.0E-16
sp|Q8HVT8|NDHI_DIMHO NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Dimeresia howellii GN=ndhI PE=3 SV=1 63 187 1.0E-16
sp|Q8HVU4|NDHI_CORPT NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Coreopsis petrophiloides GN=ndhI PE=3 SV=1 63 187 1.0E-16
sp|A4QLY9|NDHI_NASOF NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Nasturtium officinale GN=ndhI PE=3 SV=1 63 187 1.0E-16
sp|Q8HVN1|NDHI_PEROV NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Perymeniopsis ovalifolia GN=ndhI PE=3 SV=1 63 187 1.0E-16
sp|A4QKP9|NDHI_CAPBU NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Capsella bursa-pastoris GN=ndhI PE=3 SV=1 63 187 1.0E-16
sp|A4QKG1|NDHI_BARVE NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Barbarea verna GN=ndhI PE=3 SV=1 63 187 1.0E-16
sp|A4QLG3|NDHI_LEPVR NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Lepidium virginicum GN=ndhI PE=3 SV=1 63 187 1.0E-16
sp|Q32S03|NDHI_STAPU NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Staurastrum punctulatum GN=ndhI PE=3 SV=1 63 187 1.0E-16
sp|A4QJY6|NDHI_OLIPU NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Olimarabidopsis pumila GN=ndhI PE=3 SV=1 63 187 1.0E-16
sp|A4QKY8|NDHI_CRUWA NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Crucihimalaya wallichii GN=ndhI PE=3 SV=1 63 187 1.0E-16
sp|Q06R76|NDHI_JASNU NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Jasminum nudiflorum GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q2QD37|NDHI_CUCSA NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Cucumis sativus GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q0G9Q8|NDHI_DAUCA NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Daucus carota GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVT0|NDHI_ENYSE NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Enydra sessilis GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|A4QJH0|NDHI_AETCO NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Aethionema cordifolium GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q2L959|NDHI_GOSHI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Gossypium hirsutum GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|A0ZZ89|NDHI_GOSBA NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Gossypium barbadense GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVM2|NDHI_PSIGN NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Psilostrophe gnaphalodes GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVP7|NDHI_MARCE NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Marshallia caespitosa GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVR3|NDHI_HYMLE NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Hymenoxys lemmonii GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVR8|NDHI_HELBG NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Helenium bigelovii GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q33BW8|NDHI_NICTO NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Nicotiana tomentosiformis GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVU8|NDHI_CHAPD NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Chaetymenia peduncularis GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVJ5|NDHI_BAHTO NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Bahiopsis tomentosa GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q2VEC7|NDHI_SOLTU NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Solanum tuberosum GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q2MI46|NDHI_SOLLC NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Solanum lycopersicum GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q2MID3|NDHI_SOLBU NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Solanum bulbocastanum GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVM4|NDHI_PSAAN NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Psathyrotes annua GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVM8|NDHI_PHABO NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Phaneroglossa bolusii GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVR0|NDHI_INUBR NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Inula britannica GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVV2|NDHI_BLEZA NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Blepharispermum zanguebaricum GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVV5|NDHI_ATHGP NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Athroisma gracile subsp. psyllioides GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVN5|NDHI_PALAR NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Palafoxia arida GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|P06252|NDHI_TOBAC NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Nicotiana tabacum GN=ndhI PE=1 SV=1 63 187 2.0E-16
sp|Q68RV2|NDHI_PANGI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Panax ginseng GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q3C1Q0|NDHI_NICSY NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Nicotiana sylvestris GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q7FNR7|NDHI_ATRBE NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Atropa belladonna GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVJ9|NDHI_TRIME NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Trigonospermum melampodioides GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVL4|NDHI_SIGBL NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Sigesbeckia blakei GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVP4|NDHI_MILQU NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Milleria quinqueflora GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVK7|NDHI_STERE NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Stevia rebaudiana GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVI9|NDHI_ZINJU NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Zinnia juniperifolia GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVJ1|NDHI_ZALME NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Zaluzania megacephala GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVJ4|NDHI_VILAC NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Villanova achilleoides GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVJ6|NDHI_VERJA NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Verbesina jacksonii GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVJ8|NDHI_VARMX NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Varilla mexicana GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVT4|NDHI_THYTE NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Thymophylla tenuiloba GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVK3|NDHI_TETRE NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Tetragonotheca repanda GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVK4|NDHI_TETOR NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Tetrachyron orizabensis GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVK5|NDHI_TARER NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Tagetes erecta GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVK9|NDHI_SQUKU NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Squamopappus skutchii GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVL0|NDHI_SPIUR NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Spilanthes urens GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVL2|NDHI_SMAMI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Smallanthus microcephalus GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVL5|NDHI_RUMPE NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Rumfordia penninervis GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVL6|NDHI_RUDHI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Rudbeckia hirta GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVL7|NDHI_ROJSU NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Rojasianthe superba GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVM0|NDHI_RATCO NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Ratibida columnifera GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVM6|NDHI_PODEM NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Podachaenium eminens GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVM9|NDHI_PEUSC NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Peucephyllum schottii GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVN3|NDHI_PERCD NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Pericome caudata GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVP0|NDHI_NEULO NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Neurolaena lobata GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVP1|NDHI_MONRV NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Montanoa revealii GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVP3|NDHI_MONPA NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Monactis pallatangensis GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVP2|NDHI_MONGR NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Monolopia gracilens GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVP8|NDHI_MADSA NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Madia sativa GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVQ6|NDHI_LAGRA NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Lagophylla ramosissima GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVQ7|NDHI_KINPA NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Kingianthus paradoxus GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVR1|NDHI_IDIQU NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Idiopappus quitensis GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVR2|NDHI_ICHTE NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Ichthyothere terminalis GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVR7|NDHI_HELAN NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Helianthus annuus GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVS0|NDHI_GRERE NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Greenmaniella resinosa GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVS1|NDHI_GALQU NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Galinsoga quadriradiata GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVS2|NDHI_GALPT NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Galeana pratensis GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVS3|NDHI_FLOPE NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Florestina pedata GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVS4|NDHI_FLARA NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Flaveria ramosissima GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVS5|NDHI_EUTPA NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Eutetras palmeri GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVT5|NDHI_DYSMI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Dyscritothamnus mirandae GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVT6|NDHI_DUGME NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Dugesia mexicana GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVT9|NDHI_DESFU NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Desmanthodium fruticosum GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVU2|NDHI_DAHCO NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Dahlia coccinea GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVU3|NDHI_CYMVE NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Cymophora venezuelensis GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVS8|NDHI_CONNE NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Constancea nevinii GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVU6|NDHI_CHRHE NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Chromolepis heterophylla GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVV3|NDHI_BEBJU NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Bebbia juncea GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVV6|NDHI_ARNMO NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Arnica mollis GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVJ2|NDHI_ARNDE NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Arnica dealbata GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVK6|NDHI_SYNNO NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Synedrella nodiflora GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVK8|NDHI_STESO NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Steiractinia sodiroi GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVQ5|NDHI_LASMA NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Lasianthaea macrocephala GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVR9|NDHI_GUATU NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Guardiola tulocarpus GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVU0|NDHI_DELBI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Delilia biflora GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVU1|NDHI_DAMCA NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Damnxanthodium calvum GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVV0|NDHI_CALVA NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Calyptocarpus vialis GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q7I7Y4|NDHI_ZEXSE NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Zexmenia serrata GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVJ0|NDHI_WEDTE NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Wedelia tegetis GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVJ3|NDHI_TILBA NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Tilesia baccata GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVK2|NDHI_SPHTR NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Sphagneticola trilobata GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVL1|NDHI_PERMO NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Perymenium macrocephalum GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVN7|NDHI_OXYSB NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Oxypappus scaber GN=ndhI PE=3 SV=2 63 187 2.0E-16
sp|Q8HVN6|NDHI_MELNV NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Melanthera nivea GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVP5|NDHI_LUNJA NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Lundellianthus jaliscensis GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVP9|NDHI_LIPIN NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Lipochaeta integrifolia GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVQ1|NDHI_ECLPR NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Eclipta prostrata GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVT7|NDHI_DIMVE NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Dimerostemma vestitum GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVS6|NDHI_COETI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Coespeletia timotensis GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVU5|NDHI_CLIAL NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Clibadium alatum GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVV7|NDHI_APHJA NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Aphanactis jamesoniana GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVQ2|NDHI_TRIPN NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Trilisa paniculata GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVL3|NDHI_SILPE NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Silphium perfoliatum GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVN2|NDHI_PERLI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Perityle lindheimeri GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q332S3|NDHI_LACSA NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Lactuca sativa GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVV4|NDHI_BAHAB NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Bahia absinthifolia GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVN4|NDHI_PARHY NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Parthenium hysterophorus GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVR6|NDHI_HOFFA NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Hofmeisteria fasciculata GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVV8|NDHI_AMBTR NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Ambrosia trifida GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVL9|NDHI_RIEOB NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Riencourtia oblongifolia GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVT2|NDHI_ENCCL NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Encelia californica GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVM5|NDHI_POLCN NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Polymnia canadensis GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVN9|NDHI_OBLMI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Oblivia mikanioides GN=ndhI PE=3 SV=1 63 187 2.0E-16
sp|Q8HVJ7|NDHI_VENCA NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Venegasia carpesioides GN=ndhI PE=3 SV=1 63 187 3.0E-16
sp|Q8HVM3|NDHI_PSEAR NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Pseudoclappia arenaria GN=ndhI PE=3 SV=1 63 187 3.0E-16
sp|Q8HVM7|NDHI_PHIZI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Philactis zinnioides GN=ndhI PE=3 SV=1 63 187 3.0E-16
sp|Q8HVN8|NDHI_OTESC NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Oteiza scandens GN=ndhI PE=3 SV=1 63 187 3.0E-16
sp|Q8HVQ3|NDHI_MONCO NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Monolopia congdonii GN=ndhI PE=3 SV=1 63 187 3.0E-16
sp|Q8HVQ0|NDHI_LOXSI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Loxothysanus sinuatus GN=ndhI PE=3 SV=1 63 187 3.0E-16
sp|Q8HVQ4|NDHI_LAYHE NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Layia heterotricha GN=ndhI PE=3 SV=1 63 187 3.0E-16
sp|Q8HVQ8|NDHI_JAUCA NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Jaumea carnosa GN=ndhI PE=3 SV=1 63 187 3.0E-16
sp|Q8HVQ9|NDHI_JAEHI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Jaegeria hirta GN=ndhI PE=3 SV=1 63 187 3.0E-16
sp|Q8HVR4|NDHI_HYMFF NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Hymenopappus filifolius var. filifolius GN=ndhI PE=3 SV=1 63 187 3.0E-16
sp|Q8HVS9|NDHI_ERIST NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Eriophyllum staechadifolium GN=ndhI PE=3 SV=1 63 187 3.0E-16
sp|Q8HVS7|NDHI_ERICN NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Eriophyllum congdonii GN=ndhI PE=3 SV=1 63 187 3.0E-16
sp|Q8HVT1|NDHI_ENGPE NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Engelmannia peristenia GN=ndhI PE=3 SV=1 63 187 3.0E-16
sp|Q8HVV1|NDHI_CALME NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Calea megacephala GN=ndhI PE=3 SV=1 63 187 3.0E-16
sp|Q8HVW2|NDHI_ACMRA NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Acmella radicans GN=ndhI PE=3 SV=1 63 187 3.0E-16
sp|Q8HVL8|NDHI_RENSL NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Rensonia salvadorica GN=ndhI PE=3 SV=1 63 187 3.0E-16
sp|Q9MTH8|NDHI_OENEH NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Oenothera elata subsp. hookeri GN=ndhI PE=3 SV=2 63 187 3.0E-16
sp|Q8HVW3|NDHI_ACAAU NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Acanthospermum australe GN=ndhI PE=3 SV=1 63 187 3.0E-16
sp|P0C386|NDHI_ORYSJ NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Oryza sativa subsp. japonica GN=ndhI PE=3 SV=1 38 187 3.0E-16
sp|P0C385|NDHI_ORYSI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Oryza sativa subsp. indica GN=ndhI PE=3 SV=1 38 187 3.0E-16
sp|P0C384|NDHI_ORYSA NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Oryza sativa GN=ndhI PE=3 SV=1 38 187 3.0E-16
sp|Q6ENA3|NDHI_ORYNI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Oryza nivara GN=ndhI PE=3 SV=1 38 187 3.0E-16
sp|Q09MC2|NDHI_CITSI NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Citrus sinensis GN=ndhI PE=3 SV=1 38 187 3.0E-16
sp|A1ALP7|NUOI_PELPD NADH-quinone oxidoreductase subunit I OS=Pelobacter propionicus (strain DSM 2379) GN=nuoI1 PE=3 SV=1 50 196 3.0E-16
sp|Q5SCZ1|NDHI_HUPLU NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Huperzia lucidula GN=ndhI PE=3 SV=1 63 187 3.0E-16
sp|Q06FQ0|NDHI_PELHO NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Pelargonium hortorum GN=ndhI PE=3 SV=1 63 187 3.0E-16
sp|Q8HVM1|NDHI_RAIAR NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Raillardella argentea GN=ndhI PE=3 SV=1 63 187 3.0E-16
sp|Q8HVU9|NDHI_CHAST NAD(P)H-quinone oxidoreductase subunit I, chloroplastic OS=Chaenactis santolinoides GN=ndhI PE=3 SV=1 63 187 3.0E-16
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2874
MASALRPSAALLTRRSLAVCASRSYATPHGPPPKNFRTGRMTWKWEQDGMLDRLGKFFLMTEMARGMYVLLEQFF
RPPYTIYYPFEKGPISPRFRGEHALRRYPSGEERCIACKLCEAICPAQAITIEAEERADGSRRTTRYDIDMTKCI
YCGFCQESCPVDAIVESPNAEYATETREELLYNKEKLLNNGDKWEPELAAVIRADAPYR*
Coding >OphauB2|2874
ATGGCGTCCGCACTACGTCCCTCGGCCGCCCTCCTCACCCGCCGCTCCCTCGCCGTCTGCGCTTCCCGCTCATAT
GCCACGCCTCACGGCCCGCCTCCCAAAAACTTTCGCACCGGCCGCATGACGTGGAAGTGGGAACAAGACGGCATG
CTCGATCGCCTCGGCAAGTTTTTTCTCATGACGGAAATGGCGCGCGGCATGTACGTGCTGCTCGAGCAGTTTTTC
CGCCCTCCATACACAATCTACTACCCCTTTGAAAAGGGCCCCATTTCCCCCCGCTTTCGAGGCGAACACGCTCTA
CGTCGATACCCGTCTGGTGAAGAACGCTGCATCGCCTGCAAGCTCTGCGAAGCCATTTGTCCCGCCCAAGCCATC
ACCATTGAGGCGGAAGAACGCGCCGACGGCTCCCGCCGCACCACGCGCTACGACATTGACATGACAAAGTGCATC
TACTGCGGCTTTTGCCAAGAATCATGCCCCGTCGACGCCATTGTCGAAAGCCCAAATGCAGAATACGCTACCGAA
ACGAGGGAAGAGTTGCTCTACAATAAGGAAAAATTATTAAATAATGGAGACAAGTGGGAGCCTGAACTCGCCGCC
GTCATTCGGGCCGACGCTCCATATCGATAG
Transcript >OphauB2|2874
ATGGCGTCCGCACTACGTCCCTCGGCCGCCCTCCTCACCCGCCGCTCCCTCGCCGTCTGCGCTTCCCGCTCATAT
GCCACGCCTCACGGCCCGCCTCCCAAAAACTTTCGCACCGGCCGCATGACGTGGAAGTGGGAACAAGACGGCATG
CTCGATCGCCTCGGCAAGTTTTTTCTCATGACGGAAATGGCGCGCGGCATGTACGTGCTGCTCGAGCAGTTTTTC
CGCCCTCCATACACAATCTACTACCCCTTTGAAAAGGGCCCCATTTCCCCCCGCTTTCGAGGCGAACACGCTCTA
CGTCGATACCCGTCTGGTGAAGAACGCTGCATCGCCTGCAAGCTCTGCGAAGCCATTTGTCCCGCCCAAGCCATC
ACCATTGAGGCGGAAGAACGCGCCGACGGCTCCCGCCGCACCACGCGCTACGACATTGACATGACAAAGTGCATC
TACTGCGGCTTTTGCCAAGAATCATGCCCCGTCGACGCCATTGTCGAAAGCCCAAATGCAGAATACGCTACCGAA
ACGAGGGAAGAGTTGCTCTACAATAAGGAAAAATTATTAAATAATGGAGACAAGTGGGAGCCTGAACTCGCCGCC
GTCATTCGGGCCGACGCTCCATATCGATAG
Gene >OphauB2|2874
ATGGCGTCCGCACTACGTCCCTCGGCCGCCCTCCTCACCCGCCGCTCCCTCGCCGTCTGCGCTTCCCGCTCATAT
GCCACGCCTCACGGCCCGCCTCCCAAAAACTTTCGCACCGGCCGCATGACGTGGAAGTGGGAACAAGACGGCATG
CTCGATCGCCTCGGCAAGTTTTTTCTCATGACGGAAATGGCGCGCGGCATGTACGTGCTGCTCGAGCAGTTTTTC
CGCCCTCCGTACGTTGTTTCTTTTGCCAGTTCTTCTTCTTAACCCCCCCCCCCCCCGGCTCTTGTTCCCCTCTTG
CCATTATTACTTGTCACCAGACTAACTTGCCCGCCAGATACACAATCTACTACCCCTTTGAAAAGGTTGTCAAGC
CAATCCCCTTTCCACCCACTTACCCTGAAACTAACCCTCCTCAACCAGGGCCCCATTTCCCCCCGCTTTCGAGGC
GAACACGCTCTACGTCGATACCCGTCTGGTGAAGAACGCTGCATCGCCTGCAAGCTCTGCGAAGCCGTACGCCCA
CCCGCTCTTGTCCTCGTCGCCTTTTCTTAACTCACTCACTCACTCCAACTCCAGATTTGTCCCGCCCAAGCCATC
ACCATTGAGGCGGAAGAACGCGCCGACGGCTCCCGCCGCACCACGCGCTACGACATTGACATGACAAAGTGCATC
TACTGCGGCTTTTGCCAAGAATCATGCCCCGTCGACGCCATTGTCGAAAGCCCAAATGCAGAATACGCTACCGAA
ACGAGGGAAGAGTTGCTCTACAATAAGGGTGCGTGTGCAGACTCCTTTTTATCCCAGACTCCTTTTTACCCCAAA
CTCCTTTTTACCCCAGACTCTATTTTATCCCAGACTCCTTTTTATCCCAGACTCTATTTTATCCCCATTTCTCCT
CCTCGCTCCTTGCTCGCCCAACCCCCCCCTCGCCATGTAGCACTCCTTGAAAACTAACCCCTTGCGTGGCAGAAA
AATTATTAAATAATGGAGACAAGTGGGAGCCTGAACTCGCCGCCGTCATTCGGGCCGACGCTCCATATCGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail