Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|2868
Gene name
LocationContig_197:11067..12644
Strand+
Gene length (bp)1577
Transcript length (bp)873
Coding sequence length (bp)873
Protein length (aa) 291

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16123 HAGH_C Hydroxyacylglutathione hydrolase C-terminus 6.4E-24 206 283
PF00753 Lactamase_B Metallo-beta-lactamase superfamily 2.2E-11 38 107
PF00753 Lactamase_B Metallo-beta-lactamase superfamily 3.9E-05 133 205

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UT36|GLO21_SCHPO Probable hydroxyacylglutathione hydrolase C824.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC824.07 PE=3 SV=1 27 282 8.0E-97
sp|O94250|GLO22_SCHPO Probable hydroxyacylglutathione hydrolase C13B11.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC13B11.03c PE=3 SV=1 27 282 3.0E-90
sp|Q05584|GLO2_YEAST Hydroxyacylglutathione hydrolase, cytoplasmic isozyme OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GLO2 PE=1 SV=1 28 281 6.0E-71
sp|Q12320|GLO4_YEAST Hydroxyacylglutathione hydrolase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GLO4 PE=3 SV=1 26 283 5.0E-63
sp|Q6P963|GLO2_DANRE Hydroxyacylglutathione hydrolase, mitochondrial OS=Danio rerio GN=hagh PE=2 SV=2 3 287 6.0E-56
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UT36|GLO21_SCHPO Probable hydroxyacylglutathione hydrolase C824.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC824.07 PE=3 SV=1 27 282 8.0E-97
sp|O94250|GLO22_SCHPO Probable hydroxyacylglutathione hydrolase C13B11.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC13B11.03c PE=3 SV=1 27 282 3.0E-90
sp|Q05584|GLO2_YEAST Hydroxyacylglutathione hydrolase, cytoplasmic isozyme OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GLO2 PE=1 SV=1 28 281 6.0E-71
sp|Q12320|GLO4_YEAST Hydroxyacylglutathione hydrolase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GLO4 PE=3 SV=1 26 283 5.0E-63
sp|Q6P963|GLO2_DANRE Hydroxyacylglutathione hydrolase, mitochondrial OS=Danio rerio GN=hagh PE=2 SV=2 3 287 6.0E-56
sp|Q16775|GLO2_HUMAN Hydroxyacylglutathione hydrolase, mitochondrial OS=Homo sapiens GN=HAGH PE=1 SV=2 28 288 1.0E-55
sp|Q99KB8|GLO2_MOUSE Hydroxyacylglutathione hydrolase, mitochondrial OS=Mus musculus GN=Hagh PE=1 SV=2 28 288 2.0E-55
sp|Q28333|GLO2_CALJA Hydroxyacylglutathione hydrolase, mitochondrial (Fragment) OS=Callithrix jacchus GN=HAGH PE=2 SV=2 28 288 2.0E-55
sp|B4F6K2|GLO2_XENTR Hydroxyacylglutathione hydrolase, mitochondrial OS=Xenopus tropicalis GN=hagh PE=2 SV=1 18 288 3.0E-55
sp|Q3B7M2|GLO2_BOVIN Hydroxyacylglutathione hydrolase, mitochondrial OS=Bos taurus GN=HAGH PE=2 SV=3 41 288 1.0E-54
sp|O35952|GLO2_RAT Hydroxyacylglutathione hydrolase, mitochondrial OS=Rattus norvegicus GN=Hagh PE=1 SV=2 28 288 2.0E-54
sp|Q4R6C1|GLO2_MACFA Hydroxyacylglutathione hydrolase, mitochondrial OS=Macaca fascicularis GN=HAGH PE=2 SV=2 28 288 2.0E-53
sp|Q5ZI23|GLO2_CHICK Hydroxyacylglutathione hydrolase, mitochondrial OS=Gallus gallus GN=HAGH PE=2 SV=1 22 288 2.0E-52
sp|O24496|GLO2C_ARATH Hydroxyacylglutathione hydrolase cytoplasmic OS=Arabidopsis thaliana GN=GLX2-2 PE=1 SV=2 41 284 5.0E-52
sp|Q5ZLY2|HAGHL_CHICK Hydroxyacylglutathione hydrolase-like protein OS=Gallus gallus GN=HAGHL PE=2 SV=1 28 289 3.0E-48
sp|Q54MR1|GLO2_DICDI Hydroxyacylglutathione hydrolase OS=Dictyostelium discoideum GN=hagh PE=3 SV=1 30 283 2.0E-46
sp|B1WUT9|GLO2_CYAA5 Hydroxyacylglutathione hydrolase OS=Cyanothece sp. (strain ATCC 51142) GN=gloB PE=3 SV=1 28 283 2.0E-42
sp|B2IVH7|GLO2_NOSP7 Hydroxyacylglutathione hydrolase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=gloB PE=3 SV=1 41 283 2.0E-40
sp|Q5N5S6|GLO2_SYNP6 Hydroxyacylglutathione hydrolase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=gloB PE=3 SV=2 28 283 4.0E-40
sp|Q31ND6|GLO2_SYNE7 Hydroxyacylglutathione hydrolase OS=Synechococcus elongatus (strain PCC 7942) GN=gloB PE=3 SV=1 28 283 4.0E-40
sp|Q0AM20|GLO2_MARMM Hydroxyacylglutathione hydrolase OS=Maricaulis maris (strain MCS10) GN=gloB PE=3 SV=1 41 283 1.0E-39
sp|B7K3R6|GLO2_CYAP8 Hydroxyacylglutathione hydrolase OS=Cyanothece sp. (strain PCC 8801) GN=gloB PE=3 SV=1 28 283 2.0E-39
sp|Q2RP80|GLO2_RHORT Hydroxyacylglutathione hydrolase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=gloB PE=3 SV=1 41 283 2.0E-39
sp|P72933|GLO2_SYNY3 Hydroxyacylglutathione hydrolase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=gloB PE=3 SV=1 28 283 9.0E-39
sp|Q2JPX4|GLO2_SYNJB Hydroxyacylglutathione hydrolase OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=gloB PE=3 SV=1 41 283 1.0E-38
sp|Q3MGD2|GLO2_ANAVT Hydroxyacylglutathione hydrolase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=gloB PE=3 SV=1 41 283 2.0E-38
sp|Q8YZ99|GLO2_NOSS1 Hydroxyacylglutathione hydrolase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=gloB PE=3 SV=1 41 283 4.0E-38
sp|B0JW10|GLO2_MICAN Hydroxyacylglutathione hydrolase OS=Microcystis aeruginosa (strain NIES-843) GN=gloB PE=3 SV=1 41 283 6.0E-38
sp|Q89XT5|GLO2_BRADU Hydroxyacylglutathione hydrolase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=gloB PE=3 SV=1 41 281 9.0E-38
sp|Q9DB32|HAGHL_MOUSE Hydroxyacylglutathione hydrolase-like protein OS=Mus musculus GN=Haghl PE=1 SV=1 28 288 2.0E-37
sp|Q5LNN5|GLO2_RUEPO Hydroxyacylglutathione hydrolase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=gloB PE=3 SV=1 28 283 5.0E-37
sp|B7KEB4|GLO2_CYAP7 Hydroxyacylglutathione hydrolase OS=Cyanothece sp. (strain PCC 7424) GN=gloB PE=3 SV=1 41 283 5.0E-37
sp|A4YKS8|GLO2_BRASO Hydroxyacylglutathione hydrolase OS=Bradyrhizobium sp. (strain ORS278) GN=gloB PE=3 SV=1 33 281 7.0E-37
sp|A1JKA9|GLO2_YERE8 Hydroxyacylglutathione hydrolase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=gloB PE=3 SV=1 28 283 2.0E-36
sp|Q8U9W1|GLO2_AGRFC Hydroxyacylglutathione hydrolase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=gloB PE=3 SV=2 33 283 2.0E-36
sp|Q4FP49|GLO2_PELUB Hydroxyacylglutathione hydrolase OS=Pelagibacter ubique (strain HTCC1062) GN=gloB PE=3 SV=1 41 283 2.0E-36
sp|Q2JVC3|GLO2_SYNJA Hydroxyacylglutathione hydrolase OS=Synechococcus sp. (strain JA-3-3Ab) GN=gloB PE=3 SV=1 41 283 2.0E-36
sp|Q8LDW8|GLO2D_ARATH Probable hydroxyacylglutathione hydrolase 2, chloroplastic OS=Arabidopsis thaliana GN=GLX2-4 PE=2 SV=1 13 284 2.0E-36
sp|Q98G02|GLO2_RHILO Hydroxyacylglutathione hydrolase OS=Rhizobium loti (strain MAFF303099) GN=gloB PE=3 SV=1 33 283 3.0E-36
sp|Q92MF8|GLO2_RHIME Hydroxyacylglutathione hydrolase OS=Rhizobium meliloti (strain 1021) GN=gloB PE=3 SV=1 33 283 4.0E-36
sp|A5ETG1|GLO2_BRASB Hydroxyacylglutathione hydrolase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=gloB PE=3 SV=1 33 281 4.0E-36
sp|Q8Z983|GLO2_SALTI Hydroxyacylglutathione hydrolase OS=Salmonella typhi GN=gloB PE=3 SV=1 28 283 7.0E-36
sp|Q10Y41|GLO2_TRIEI Hydroxyacylglutathione hydrolase OS=Trichodesmium erythraeum (strain IMS101) GN=gloB PE=3 SV=1 28 283 2.0E-35
sp|Q3IIR9|GLO2_PSEHT Hydroxyacylglutathione hydrolase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=gloB PE=3 SV=1 40 283 3.0E-35
sp|Q13F06|GLO2_RHOPS Hydroxyacylglutathione hydrolase OS=Rhodopseudomonas palustris (strain BisB5) GN=gloB PE=3 SV=1 27 282 4.0E-35
sp|Q2J429|GLO2_RHOP2 Hydroxyacylglutathione hydrolase OS=Rhodopseudomonas palustris (strain HaA2) GN=gloB PE=3 SV=1 27 282 5.0E-35
sp|Q8DIF1|GLO2_THEEB Hydroxyacylglutathione hydrolase OS=Thermosynechococcus elongatus (strain BP-1) GN=gloB PE=3 SV=1 41 283 7.0E-35
sp|C4K7Z9|GLO2_HAMD5 Hydroxyacylglutathione hydrolase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=gloB PE=3 SV=1 41 283 8.0E-35
sp|B0BZI8|GLO2_ACAM1 Hydroxyacylglutathione hydrolase OS=Acaryochloris marina (strain MBIC 11017) GN=gloB PE=3 SV=1 28 283 9.0E-35
sp|Q7NG34|GLO2_GLOVI Hydroxyacylglutathione hydrolase OS=Gloeobacter violaceus (strain PCC 7421) GN=gloB PE=3 SV=1 41 283 1.0E-34
sp|Q21C03|GLO2_RHOPB Hydroxyacylglutathione hydrolase OS=Rhodopseudomonas palustris (strain BisB18) GN=gloB PE=3 SV=1 41 281 2.0E-34
sp|Q9SID3|GLO2N_ARATH Hydroxyacylglutathione hydrolase 2, mitochondrial OS=Arabidopsis thaliana GN=At2g31350 PE=1 SV=1 13 283 2.0E-34
sp|A1SS88|GLO2_PSYIN Hydroxyacylglutathione hydrolase OS=Psychromonas ingrahamii (strain 37) GN=gloB PE=3 SV=1 41 283 6.0E-34
sp|A4SPI6|GLO2_AERS4 Hydroxyacylglutathione hydrolase OS=Aeromonas salmonicida (strain A449) GN=gloB PE=3 SV=1 30 283 8.0E-34
sp|Q69ZP3|PNKD_MOUSE Probable hydrolase PNKD OS=Mus musculus GN=Pnkd PE=1 SV=2 30 265 9.0E-34
sp|A7YY46|PNKD_BOVIN Probable hydrolase PNKD OS=Bos taurus GN=PNKD PE=2 SV=1 30 284 1.0E-33
sp|A4W6V2|GLO2_ENT38 Hydroxyacylglutathione hydrolase OS=Enterobacter sp. (strain 638) GN=gloB PE=3 SV=1 28 283 1.0E-33
sp|Q6NC62|GLO2_RHOPA Hydroxyacylglutathione hydrolase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=gloB PE=3 SV=1 30 282 1.0E-33
sp|Q8N490|PNKD_HUMAN Probable hydrolase PNKD OS=Homo sapiens GN=PNKD PE=1 SV=2 30 255 2.0E-33
sp|Q60BX0|GLO2_METCA Hydroxyacylglutathione hydrolase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=gloB PE=3 SV=1 41 284 3.0E-33
sp|Q26547|GLO2_SCHMA Probable hydroxyacylglutathione hydrolase OS=Schistosoma mansoni PE=2 SV=1 73 283 4.0E-33
sp|Q3SVQ1|GLO2_NITWN Hydroxyacylglutathione hydrolase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=gloB PE=3 SV=1 33 281 5.0E-33
sp|B0CIU0|GLO2_BRUSI Hydroxyacylglutathione hydrolase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=gloB PE=3 SV=1 33 283 1.0E-32
sp|C0RFI1|GLO2_BRUMB Hydroxyacylglutathione hydrolase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=gloB PE=3 SV=1 33 283 1.0E-32
sp|A9M8S2|GLO2_BRUC2 Hydroxyacylglutathione hydrolase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=gloB PE=3 SV=1 33 283 1.0E-32
sp|B2S889|GLO2_BRUA1 Hydroxyacylglutathione hydrolase OS=Brucella abortus (strain S19) GN=gloB PE=3 SV=1 33 283 1.0E-32
sp|Q4ZVL3|GLO2_PSEU2 Hydroxyacylglutathione hydrolase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=gloB PE=3 SV=1 28 283 1.0E-32
sp|Q8FYE7|GLO2_BRUSU Hydroxyacylglutathione hydrolase OS=Brucella suis biovar 1 (strain 1330) GN=gloB PE=3 SV=1 33 283 1.0E-32
sp|A5VSR1|GLO2_BRUO2 Hydroxyacylglutathione hydrolase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=gloB PE=3 SV=2 33 283 1.0E-32
sp|Q8YJF4|GLO2_BRUME Hydroxyacylglutathione hydrolase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=gloB PE=3 SV=1 33 283 1.0E-32
sp|Q57AW2|GLO2_BRUAB Hydroxyacylglutathione hydrolase OS=Brucella abortus biovar 1 (strain 9-941) GN=gloB PE=3 SV=1 33 283 1.0E-32
sp|Q2YLU8|GLO2_BRUA2 Hydroxyacylglutathione hydrolase OS=Brucella abortus (strain 2308) GN=gloB PE=3 SV=1 33 283 1.0E-32
sp|A4G7G5|GLO2_HERAR Hydroxyacylglutathione hydrolase OS=Herminiimonas arsenicoxydans GN=gloB PE=3 SV=1 28 284 2.0E-32
sp|B3R1Y0|GLO2_CUPTR Hydroxyacylglutathione hydrolase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=gloB PE=3 SV=1 28 284 2.0E-32
sp|A6T510|GLO2_KLEP7 Hydroxyacylglutathione hydrolase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=gloB PE=3 SV=1 28 283 2.0E-32
sp|Q87YS8|GLO2_PSESM Hydroxyacylglutathione hydrolase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=gloB PE=3 SV=1 28 283 3.0E-32
sp|Q1CFI4|GLO2_YERPN Hydroxyacylglutathione hydrolase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=gloB PE=3 SV=1 28 283 5.0E-32
sp|Q0WHW5|GLO2_YERPE Hydroxyacylglutathione hydrolase OS=Yersinia pestis GN=gloB PE=3 SV=1 28 283 5.0E-32
sp|Q1CAJ7|GLO2_YERPA Hydroxyacylglutathione hydrolase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=gloB PE=3 SV=1 28 283 5.0E-32
sp|B1JR44|GLO2_YERPY Hydroxyacylglutathione hydrolase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=gloB PE=3 SV=1 28 283 7.0E-32
sp|Q667M5|GLO2_YERPS Hydroxyacylglutathione hydrolase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=gloB PE=3 SV=1 28 283 7.0E-32
sp|B2KAD1|GLO2_YERPB Hydroxyacylglutathione hydrolase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=gloB PE=3 SV=1 28 283 7.0E-32
sp|A7FFK5|GLO2_YERP3 Hydroxyacylglutathione hydrolase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=gloB PE=3 SV=1 28 283 7.0E-32
sp|B5Y1G4|GLO2_KLEP3 Hydroxyacylglutathione hydrolase OS=Klebsiella pneumoniae (strain 342) GN=gloB PE=3 SV=1 28 283 8.0E-32
sp|Q1QQZ1|GLO2_NITHX Hydroxyacylglutathione hydrolase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=gloB PE=3 SV=1 64 281 8.0E-32
sp|Q87MG0|GLO2_VIBPA Hydroxyacylglutathione hydrolase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=gloB PE=3 SV=1 28 283 9.0E-32
sp|Q48KX8|GLO2_PSE14 Hydroxyacylglutathione hydrolase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=gloB PE=3 SV=1 28 283 1.0E-31
sp|A1U0V1|GLO2_MARHV Hydroxyacylglutathione hydrolase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=gloB PE=3 SV=1 28 283 1.0E-31
sp|Q21YF8|GLO2_RHOFT Hydroxyacylglutathione hydrolase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=gloB PE=3 SV=2 30 283 1.0E-31
sp|A8AKR2|GLO2_CITK8 Hydroxyacylglutathione hydrolase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=gloB PE=3 SV=1 28 283 2.0E-31
sp|Q1QW62|GLO2_CHRSD Hydroxyacylglutathione hydrolase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=gloB PE=3 SV=1 41 283 2.0E-31
sp|Q07VA9|GLO2_RHOP5 Hydroxyacylglutathione hydrolase OS=Rhodopseudomonas palustris (strain BisA53) GN=gloB PE=3 SV=1 33 281 2.0E-31
sp|B8HMJ9|GLO2_CYAP4 Hydroxyacylglutathione hydrolase OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=gloB PE=3 SV=1 28 283 3.0E-31
sp|Q5ZVZ3|GLO2_LEGPH Hydroxyacylglutathione hydrolase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=gloB PE=3 SV=1 40 284 3.0E-31
sp|C3LPP0|GLO2_VIBCM Hydroxyacylglutathione hydrolase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=gloB PE=3 SV=1 28 283 4.0E-31
sp|Q9KPX6|GLO2_VIBCH Hydroxyacylglutathione hydrolase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=gloB PE=3 SV=1 28 283 4.0E-31
sp|A5F635|GLO2_VIBC3 Hydroxyacylglutathione hydrolase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=gloB PE=3 SV=1 28 283 4.0E-31
sp|A5IBE7|GLO2_LEGPC Hydroxyacylglutathione hydrolase OS=Legionella pneumophila (strain Corby) GN=gloB PE=3 SV=1 40 284 5.0E-31
sp|Q7N809|GLO2_PHOLL Hydroxyacylglutathione hydrolase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=gloB PE=3 SV=1 28 283 5.0E-31
sp|B1XQ70|GLO2_SYNP2 Hydroxyacylglutathione hydrolase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=gloB PE=3 SV=1 28 283 6.0E-31
sp|A4TL56|GLO2_YERPP Hydroxyacylglutathione hydrolase OS=Yersinia pestis (strain Pestoides F) GN=gloB PE=3 SV=1 28 283 6.0E-31
sp|A4XU09|GLO2_PSEMY Hydroxyacylglutathione hydrolase OS=Pseudomonas mendocina (strain ymp) GN=gloB PE=3 SV=1 41 283 8.0E-31
sp|Q46Z82|GLO2_CUPPJ Hydroxyacylglutathione hydrolase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=gloB PE=3 SV=1 28 284 9.0E-31
sp|C6DC67|GLO2_PECCP Hydroxyacylglutathione hydrolase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=gloB PE=3 SV=1 28 283 1.0E-30
sp|Q2K3M6|GLO2_RHIEC Hydroxyacylglutathione hydrolase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=gloB PE=3 SV=1 41 283 1.0E-30
sp|Q11DS3|GLO2_CHESB Hydroxyacylglutathione hydrolase OS=Chelativorans sp. (strain BNC1) GN=gloB PE=3 SV=1 33 283 2.0E-30
sp|A6WXE0|GLO2_OCHA4 Hydroxyacylglutathione hydrolase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=gloB PE=3 SV=1 33 283 2.0E-30
sp|Q3Z5F1|GLO2_SHISS Hydroxyacylglutathione hydrolase OS=Shigella sonnei (strain Ss046) GN=gloB PE=3 SV=1 28 283 2.0E-30
sp|B2U350|GLO2_SHIB3 Hydroxyacylglutathione hydrolase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=gloB PE=3 SV=1 28 283 2.0E-30
sp|A7ZHU8|GLO2_ECO24 Hydroxyacylglutathione hydrolase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=gloB PE=3 SV=1 28 283 2.0E-30
sp|B7VIP5|GLO2_VIBTL Hydroxyacylglutathione hydrolase OS=Vibrio tasmaniensis (strain LGP32) GN=gloB PE=3 SV=1 28 283 2.0E-30
sp|B7M211|GLO2_ECO8A Hydroxyacylglutathione hydrolase OS=Escherichia coli O8 (strain IAI1) GN=gloB PE=3 SV=1 28 283 2.0E-30
sp|B7LHB8|GLO2_ECO55 Hydroxyacylglutathione hydrolase OS=Escherichia coli (strain 55989 / EAEC) GN=gloB PE=3 SV=1 28 283 2.0E-30
sp|Q5X5R2|GLO2_LEGPA Hydroxyacylglutathione hydrolase OS=Legionella pneumophila (strain Paris) GN=gloB PE=3 SV=1 40 284 4.0E-30
sp|Q28TK3|GLO2_JANSC Hydroxyacylglutathione hydrolase OS=Jannaschia sp. (strain CCS1) GN=gloB PE=3 SV=1 41 283 4.0E-30
sp|Q5WX41|GLO2_LEGPL Hydroxyacylglutathione hydrolase OS=Legionella pneumophila (strain Lens) GN=gloB PE=3 SV=1 40 284 5.0E-30
sp|B6HZS5|GLO2_ECOSE Hydroxyacylglutathione hydrolase OS=Escherichia coli (strain SE11) GN=gloB PE=3 SV=1 28 283 5.0E-30
sp|Q9PBI4|GLO2_XYLFA Hydroxyacylglutathione hydrolase OS=Xylella fastidiosa (strain 9a5c) GN=gloB PE=3 SV=1 41 283 6.0E-30
sp|Q8SSH0|GLO2_ENCCU Probable hydroxyacylglutathione hydrolase ECU02_0580 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU02_0580 PE=1 SV=2 28 283 6.0E-30
sp|Q6D1V5|GLO2_PECAS Hydroxyacylglutathione hydrolase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=gloB PE=3 SV=1 28 283 7.0E-30
sp|Q8DBD8|GLO2_VIBVU Hydroxyacylglutathione hydrolase OS=Vibrio vulnificus (strain CMCP6) GN=gloB PE=3 SV=1 28 283 7.0E-30
sp|Q7MII4|GLO22_VIBVY Hydroxyacylglutathione hydrolase 2 OS=Vibrio vulnificus (strain YJ016) GN=gloB2 PE=3 SV=1 28 283 7.0E-30
sp|P0AC84|GLO2_ECOLI Hydroxyacylglutathione hydrolase OS=Escherichia coli (strain K12) GN=gloB PE=1 SV=1 28 283 8.0E-30
sp|B1XD76|GLO2_ECODH Hydroxyacylglutathione hydrolase OS=Escherichia coli (strain K12 / DH10B) GN=gloB PE=3 SV=1 28 283 8.0E-30
sp|C4ZRU9|GLO2_ECOBW Hydroxyacylglutathione hydrolase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=gloB PE=3 SV=1 28 283 8.0E-30
sp|B5Z0I6|GLO2_ECO5E Hydroxyacylglutathione hydrolase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=gloB PE=3 SV=1 28 283 8.0E-30
sp|P0AC85|GLO2_ECO57 Hydroxyacylglutathione hydrolase OS=Escherichia coli O157:H7 GN=gloB PE=3 SV=1 28 283 8.0E-30
sp|A7ZWF4|GLO2_ECOHS Hydroxyacylglutathione hydrolase OS=Escherichia coli O9:H4 (strain HS) GN=gloB PE=3 SV=1 28 283 8.0E-30
sp|Q3BWP5|GLO2_XANC5 Hydroxyacylglutathione hydrolase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=gloB PE=3 SV=1 41 284 9.0E-30
sp|B0U365|GLO2_XYLFM Hydroxyacylglutathione hydrolase OS=Xylella fastidiosa (strain M12) GN=gloB PE=3 SV=1 41 283 1.0E-29
sp|Q8PNI0|GLO2_XANAC Hydroxyacylglutathione hydrolase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=gloB PE=3 SV=1 41 284 1.0E-29
sp|Q87C74|GLO2_XYLFT Hydroxyacylglutathione hydrolase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=gloB PE=3 SV=1 41 283 1.0E-29
sp|B2I5S5|GLO2_XYLF2 Hydroxyacylglutathione hydrolase OS=Xylella fastidiosa (strain M23) GN=gloB PE=3 SV=1 41 283 1.0E-29
sp|Q0TLC5|GLO2_ECOL5 Hydroxyacylglutathione hydrolase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=gloB PE=3 SV=1 28 283 1.0E-29
sp|B7UJA8|GLO2_ECO27 Hydroxyacylglutathione hydrolase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=gloB PE=3 SV=1 28 283 1.0E-29
sp|A0KIK2|GLO2_AERHH Hydroxyacylglutathione hydrolase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=gloB PE=3 SV=1 30 283 2.0E-29
sp|Q1H188|GLO2_METFK Hydroxyacylglutathione hydrolase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=gloB PE=3 SV=1 41 283 2.0E-29
sp|A1S6T3|GLO2_SHEAM Hydroxyacylglutathione hydrolase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=gloB PE=3 SV=1 28 283 2.0E-29
sp|A7MY07|GLO2_VIBCB Hydroxyacylglutathione hydrolase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=gloB PE=3 SV=1 28 283 2.0E-29
sp|Q6PII5|HAGHL_HUMAN Hydroxyacylglutathione hydrolase-like protein OS=Homo sapiens GN=HAGHL PE=2 SV=1 28 218 2.0E-29
sp|A5W167|GLO2_PSEP1 Hydroxyacylglutathione hydrolase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=gloB PE=3 SV=1 28 283 3.0E-29
sp|B1IPU6|GLO2_ECOLC Hydroxyacylglutathione hydrolase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=gloB PE=3 SV=1 28 283 3.0E-29
sp|A1A7Q3|GLO2_ECOK1 Hydroxyacylglutathione hydrolase OS=Escherichia coli O1:K1 / APEC GN=gloB PE=3 SV=1 28 283 3.0E-29
sp|B7MBI8|GLO2_ECO45 Hydroxyacylglutathione hydrolase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=gloB PE=3 SV=1 28 283 3.0E-29
sp|Q1RFX9|GLO2_ECOUT Hydroxyacylglutathione hydrolase OS=Escherichia coli (strain UTI89 / UPEC) GN=gloB PE=3 SV=1 28 283 3.0E-29
sp|B1LHM1|GLO2_ECOSM Hydroxyacylglutathione hydrolase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=gloB PE=3 SV=1 28 283 3.0E-29
sp|B7NKW6|GLO2_ECO7I Hydroxyacylglutathione hydrolase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=gloB PE=3 SV=1 28 283 3.0E-29
sp|Q83MC1|GLO2_SHIFL Hydroxyacylglutathione hydrolase OS=Shigella flexneri GN=gloB PE=3 SV=1 28 283 4.0E-29
sp|Q0T802|GLO2_SHIF8 Hydroxyacylglutathione hydrolase OS=Shigella flexneri serotype 5b (strain 8401) GN=gloB PE=3 SV=1 28 283 4.0E-29
sp|Q325T4|GLO2_SHIBS Hydroxyacylglutathione hydrolase OS=Shigella boydii serotype 4 (strain Sb227) GN=gloB PE=3 SV=1 28 283 4.0E-29
sp|B7N874|GLO2_ECOLU Hydroxyacylglutathione hydrolase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=gloB PE=3 SV=1 28 283 5.0E-29
sp|A9IZW8|GLO2_BART1 Hydroxyacylglutathione hydrolase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=gloB PE=3 SV=1 33 283 5.0E-29
sp|B0KN02|GLO2_PSEPG Hydroxyacylglutathione hydrolase OS=Pseudomonas putida (strain GB-1) GN=gloB PE=3 SV=1 28 283 5.0E-29
sp|B7MQ21|GLO2_ECO81 Hydroxyacylglutathione hydrolase OS=Escherichia coli O81 (strain ED1a) GN=gloB PE=3 SV=1 28 283 5.0E-29
sp|A1IPQ8|GLO2_NEIMA Hydroxyacylglutathione hydrolase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=gloB PE=3 SV=1 41 283 6.0E-29
sp|O24495|GLO2M_ARATH Hydroxyacylglutathione hydrolase 1, mitochondrial OS=Arabidopsis thaliana GN=GLX2-1 PE=2 SV=2 27 282 6.0E-29
sp|B5F9V3|GLO2_VIBFM Hydroxyacylglutathione hydrolase OS=Vibrio fischeri (strain MJ11) GN=gloB PE=3 SV=1 28 283 6.0E-29
sp|Q0BWR4|GLO2_HYPNA Hydroxyacylglutathione hydrolase OS=Hyphomonas neptunium (strain ATCC 15444) GN=gloB PE=3 SV=1 41 283 6.0E-29
sp|B0UBD0|GLO2_METS4 Hydroxyacylglutathione hydrolase OS=Methylobacterium sp. (strain 4-46) GN=gloB PE=3 SV=1 41 283 7.0E-29
sp|Q3AYI2|GLO2_SYNS9 Hydroxyacylglutathione hydrolase OS=Synechococcus sp. (strain CC9902) GN=gloB PE=3 SV=1 51 259 7.0E-29
sp|Q5E3G3|GLO2_VIBF1 Hydroxyacylglutathione hydrolase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=gloB PE=3 SV=2 28 283 1.0E-28
sp|B5R447|GLO2_SALEP Hydroxyacylglutathione hydrolase OS=Salmonella enteritidis PT4 (strain P125109) GN=gloB PE=3 SV=1 28 283 1.0E-28
sp|B5FJ56|GLO2_SALDC Hydroxyacylglutathione hydrolase OS=Salmonella dublin (strain CT_02021853) GN=gloB PE=3 SV=1 28 283 1.0E-28
sp|A0KXS9|GLO2_SHESA Hydroxyacylglutathione hydrolase OS=Shewanella sp. (strain ANA-3) GN=gloB PE=3 SV=1 41 283 1.0E-28
sp|Q12BV7|GLO2_POLSJ Hydroxyacylglutathione hydrolase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=gloB PE=3 SV=1 35 283 1.0E-28
sp|Q8ZRM2|GLO2_SALTY Hydroxyacylglutathione hydrolase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=gloB PE=1 SV=1 28 283 2.0E-28
sp|B7LW87|GLO2_ESCF3 Hydroxyacylglutathione hydrolase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=gloB PE=3 SV=1 28 283 2.0E-28
sp|Q88FF3|GLO2_PSEPK Hydroxyacylglutathione hydrolase OS=Pseudomonas putida (strain KT2440) GN=gloB PE=3 SV=1 28 283 2.0E-28
sp|Q9JXK4|GLO2_NEIMB Hydroxyacylglutathione hydrolase OS=Neisseria meningitidis serogroup B (strain MC58) GN=gloB PE=3 SV=1 41 284 2.0E-28
sp|A9M0M3|GLO2_NEIM0 Hydroxyacylglutathione hydrolase OS=Neisseria meningitidis serogroup C (strain 053442) GN=gloB PE=3 SV=1 41 284 2.0E-28
sp|B4RJC7|GLO2_NEIG2 Hydroxyacylglutathione hydrolase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=gloB PE=3 SV=1 41 284 2.0E-28
sp|B4TYG8|GLO2_SALSV Hydroxyacylglutathione hydrolase OS=Salmonella schwarzengrund (strain CVM19633) GN=gloB PE=3 SV=1 28 283 2.0E-28
sp|A9MZ21|GLO2_SALPB Hydroxyacylglutathione hydrolase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=gloB PE=3 SV=1 28 283 2.0E-28
sp|B4SV37|GLO2_SALNS Hydroxyacylglutathione hydrolase OS=Salmonella newport (strain SL254) GN=gloB PE=3 SV=1 28 283 2.0E-28
sp|B4TK83|GLO2_SALHS Hydroxyacylglutathione hydrolase OS=Salmonella heidelberg (strain SL476) GN=gloB PE=3 SV=1 28 283 2.0E-28
sp|Q57SZ8|GLO2_SALCH Hydroxyacylglutathione hydrolase OS=Salmonella choleraesuis (strain SC-B67) GN=gloB PE=3 SV=1 28 283 2.0E-28
sp|B5F8X0|GLO2_SALA4 Hydroxyacylglutathione hydrolase OS=Salmonella agona (strain SL483) GN=gloB PE=3 SV=1 28 283 2.0E-28
sp|B5BDW7|GLO2_SALPK Hydroxyacylglutathione hydrolase OS=Salmonella paratyphi A (strain AKU_12601) GN=gloB PE=3 SV=1 28 283 2.0E-28
sp|Q5PFD6|GLO2_SALPA Hydroxyacylglutathione hydrolase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=gloB PE=3 SV=1 28 283 2.0E-28
sp|B5R5L1|GLO2_SALG2 Hydroxyacylglutathione hydrolase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=gloB PE=3 SV=1 28 283 2.0E-28
sp|Q8PBY0|GLO2_XANCP Hydroxyacylglutathione hydrolase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=gloB PE=3 SV=1 28 284 3.0E-28
sp|B0RTE9|GLO2_XANCB Hydroxyacylglutathione hydrolase OS=Xanthomonas campestris pv. campestris (strain B100) GN=gloB PE=3 SV=1 28 284 3.0E-28
sp|Q4URM1|GLO2_XANC8 Hydroxyacylglutathione hydrolase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=gloB PE=3 SV=1 28 284 3.0E-28
sp|Q32JQ1|GLO2_SHIDS Hydroxyacylglutathione hydrolase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=gloB PE=3 SV=1 28 283 3.0E-28
sp|Q1LL91|GLO2_CUPMC Hydroxyacylglutathione hydrolase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=gloB PE=3 SV=1 28 284 3.0E-28
sp|C5BEP2|GLO2_EDWI9 Hydroxyacylglutathione hydrolase OS=Edwardsiella ictaluri (strain 93-146) GN=gloB PE=3 SV=1 41 283 3.0E-28
sp|Q3AL08|GLO2_SYNSC Hydroxyacylglutathione hydrolase OS=Synechococcus sp. (strain CC9605) GN=gloB PE=3 SV=1 41 285 4.0E-28
sp|Q7VD23|GLO2_PROMA Hydroxyacylglutathione hydrolase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=gloB PE=3 SV=1 51 257 5.0E-28
sp|A1KW76|GLO2_NEIMF Hydroxyacylglutathione hydrolase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=gloB PE=3 SV=1 41 284 6.0E-28
sp|Q5F7J0|GLO2_NEIG1 Hydroxyacylglutathione hydrolase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=gloB PE=3 SV=1 41 284 6.0E-28
sp|B6EJV4|GLO2_ALISL Hydroxyacylglutathione hydrolase OS=Aliivibrio salmonicida (strain LFI1238) GN=gloB PE=3 SV=1 30 283 7.0E-28
sp|Q7U5Z8|GLO2_SYNPX Hydroxyacylglutathione hydrolase OS=Synechococcus sp. (strain WH8102) GN=gloB PE=3 SV=1 41 284 9.0E-28
sp|A9MPF3|GLO2_SALAR Hydroxyacylglutathione hydrolase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=gloB PE=3 SV=1 28 283 1.0E-27
sp|Q2P6Y4|GLO2_XANOM Hydroxyacylglutathione hydrolase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=gloB PE=3 SV=1 41 283 1.0E-27
sp|A3QET2|GLO2_SHELP Hydroxyacylglutathione hydrolase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=gloB PE=3 SV=1 28 283 1.0E-27
sp|Q6G1L3|GLO2_BARHE Hydroxyacylglutathione hydrolase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=gloB PE=3 SV=1 33 283 2.0E-27
sp|Q5QZL0|GLO2_IDILO Hydroxyacylglutathione hydrolase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=gloB PE=3 SV=1 41 282 2.0E-27
sp|Q2N9P7|GLO2_ERYLH Hydroxyacylglutathione hydrolase OS=Erythrobacter litoralis (strain HTCC2594) GN=gloB PE=3 SV=1 41 283 2.0E-27
sp|Q7V6G8|GLO2_PROMM Hydroxyacylglutathione hydrolase OS=Prochlorococcus marinus (strain MIT 9313) GN=gloB PE=3 SV=1 51 254 2.0E-27
sp|Q8FKY7|GLO2_ECOL6 Hydroxyacylglutathione hydrolase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=gloB PE=3 SV=1 28 283 2.0E-27
sp|A4Y6B8|GLO2_SHEPC Hydroxyacylglutathione hydrolase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=gloB PE=3 SV=1 40 283 2.0E-27
sp|Q1MB56|GLO2_RHIL3 Hydroxyacylglutathione hydrolase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=gloB PE=3 SV=1 41 283 5.0E-27
sp|Q0I8S8|GLO2_SYNS3 Hydroxyacylglutathione hydrolase OS=Synechococcus sp. (strain CC9311) GN=gloB PE=3 SV=2 41 284 7.0E-27
sp|B8ICA2|GLO2_METNO Hydroxyacylglutathione hydrolase OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=gloB PE=3 SV=1 41 283 8.0E-27
sp|Q0AE32|GLO2_NITEC Hydroxyacylglutathione hydrolase OS=Nitrosomonas eutropha (strain C91) GN=gloB PE=3 SV=1 41 284 8.0E-27
sp|A1RK78|GLO2_SHESW Hydroxyacylglutathione hydrolase OS=Shewanella sp. (strain W3-18-1) GN=gloB PE=3 SV=1 40 283 9.0E-27
sp|P57336|GLO2_BUCAI Hydroxyacylglutathione hydrolase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=gloB PE=3 SV=1 40 281 1.0E-26
sp|A9BEI3|GLO2_PROM4 Hydroxyacylglutathione hydrolase OS=Prochlorococcus marinus (strain MIT 9211) GN=gloB PE=3 SV=1 46 254 1.0E-26
sp|Q31H51|GLO2_THICR Hydroxyacylglutathione hydrolase OS=Thiomicrospira crunogena (strain XCL-2) GN=gloB PE=3 SV=1 40 260 1.0E-26
sp|Q3JAC4|GLO2_NITOC Hydroxyacylglutathione hydrolase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=gloB PE=3 SV=1 35 283 2.0E-26
sp|B1JBN3|GLO2_PSEPW Hydroxyacylglutathione hydrolase OS=Pseudomonas putida (strain W619) GN=gloB PE=3 SV=1 28 283 2.0E-26
sp|A3D437|GLO2_SHEB5 Hydroxyacylglutathione hydrolase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=gloB PE=3 SV=1 32 260 2.0E-26
sp|A3PBT3|GLO2_PROM0 Hydroxyacylglutathione hydrolase OS=Prochlorococcus marinus (strain MIT 9301) GN=gloB PE=3 SV=2 40 259 3.0E-26
sp|C0Q6N0|GLO2_SALPC Hydroxyacylglutathione hydrolase OS=Salmonella paratyphi C (strain RKS4594) GN=gloB PE=3 SV=1 28 283 3.0E-26
sp|B0TRL8|GLO2_SHEHH Hydroxyacylglutathione hydrolase OS=Shewanella halifaxensis (strain HAW-EB4) GN=gloB PE=3 SV=1 28 283 5.0E-26
sp|Q6FYC3|GLO2_BARQU Hydroxyacylglutathione hydrolase OS=Bartonella quintana (strain Toulouse) GN=gloB PE=3 SV=1 33 283 8.0E-26
sp|A2BQ40|GLO2_PROMS Hydroxyacylglutathione hydrolase OS=Prochlorococcus marinus (strain AS9601) GN=gloB PE=3 SV=2 40 259 9.0E-26
sp|B8E5A2|GLO2_SHEB2 Hydroxyacylglutathione hydrolase OS=Shewanella baltica (strain OS223) GN=gloB PE=3 SV=1 32 260 1.0E-25
sp|A4WUN2|GLO2_RHOS5 Hydroxyacylglutathione hydrolase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=gloB PE=3 SV=1 28 283 1.0E-25
sp|B2VHJ7|GLO2_ERWT9 Hydroxyacylglutathione hydrolase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=gloB PE=3 SV=1 28 283 2.0E-25
sp|Q1I7T2|GLO2_PSEE4 Hydroxyacylglutathione hydrolase OS=Pseudomonas entomophila (strain L48) GN=gloB PE=3 SV=1 41 283 3.0E-25
sp|A6WMW5|GLO2_SHEB8 Hydroxyacylglutathione hydrolase OS=Shewanella baltica (strain OS185) GN=gloB PE=3 SV=1 32 260 3.0E-25
sp|P05446|GLO2_RHOBL Hydroxyacylglutathione hydrolase OS=Rhodobacter blasticus GN=gloB PE=3 SV=1 27 283 4.0E-25
sp|A3PIB4|GLO2_RHOS1 Hydroxyacylglutathione hydrolase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=gloB PE=3 SV=1 41 283 4.0E-25
sp|A6V707|GLO2_PSEA7 Hydroxyacylglutathione hydrolase OS=Pseudomonas aeruginosa (strain PA7) GN=gloB PE=3 SV=1 28 283 5.0E-25
sp|Q3J436|GLO2_RHOS4 Hydroxyacylglutathione hydrolase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=gloB PE=3 SV=1 41 283 5.0E-25
sp|Q0A751|GLO2_ALKEH Hydroxyacylglutathione hydrolase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=gloB PE=3 SV=1 30 281 5.0E-25
sp|A5GJK5|GLO2_SYNPW Hydroxyacylglutathione hydrolase OS=Synechococcus sp. (strain WH7803) GN=gloB PE=3 SV=1 55 284 6.0E-25
sp|Q31BX5|GLO2_PROM9 Hydroxyacylglutathione hydrolase OS=Prochlorococcus marinus (strain MIT 9312) GN=gloB PE=3 SV=1 50 254 6.0E-25
sp|A2C116|GLO2_PROM1 Hydroxyacylglutathione hydrolase OS=Prochlorococcus marinus (strain NATL1A) GN=gloB PE=3 SV=1 54 259 7.0E-25
sp|Q46GM1|GLO2_PROMT Hydroxyacylglutathione hydrolase OS=Prochlorococcus marinus (strain NATL2A) GN=gloB PE=3 SV=2 54 259 7.0E-25
sp|A6VVZ9|GLO2_MARMS Hydroxyacylglutathione hydrolase OS=Marinomonas sp. (strain MWYL1) GN=gloB PE=3 SV=1 41 283 1.0E-24
sp|A2C7W3|GLO2_PROM3 Hydroxyacylglutathione hydrolase OS=Prochlorococcus marinus (strain MIT 9303) GN=gloB PE=3 SV=1 51 284 2.0E-24
sp|Q162S3|GLO2_ROSDO Hydroxyacylglutathione hydrolase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=gloB PE=3 SV=1 28 283 2.0E-24
sp|Q3SIB0|GLO2_THIDA Hydroxyacylglutathione hydrolase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=gloB PE=3 SV=1 44 283 3.0E-24
sp|Q8EE27|GLO2_SHEON Hydroxyacylglutathione hydrolase OS=Shewanella oneidensis (strain MR-1) GN=gloB PE=3 SV=1 41 283 3.0E-24
sp|Q2NVG1|GLO2_SODGM Hydroxyacylglutathione hydrolase OS=Sodalis glossinidius (strain morsitans) GN=gloB PE=3 SV=1 28 283 3.0E-24
sp|B7VB64|GLO2_PSEA8 Hydroxyacylglutathione hydrolase OS=Pseudomonas aeruginosa (strain LESB58) GN=gloB PE=3 SV=1 28 283 4.0E-24
sp|Q9I2T1|GLO2_PSEAE Hydroxyacylglutathione hydrolase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=gloB PE=3 SV=1 28 283 5.0E-24
sp|C4LC58|GLO2_TOLAT Hydroxyacylglutathione hydrolase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=gloB PE=3 SV=1 28 283 9.0E-24
sp|A7MI37|GLO2_CROS8 Hydroxyacylglutathione hydrolase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=gloB PE=3 SV=1 28 283 1.0E-23
sp|B8F6A3|GLO2_HAEPS Hydroxyacylglutathione hydrolase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=gloB PE=3 SV=1 28 254 2.0E-23
sp|Q47FN7|GLO2_DECAR Hydroxyacylglutathione hydrolase OS=Dechloromonas aromatica (strain RCB) GN=gloB PE=3 SV=1 28 260 2.0E-23
sp|A9L0E9|GLO2_SHEB9 Hydroxyacylglutathione hydrolase OS=Shewanella baltica (strain OS195) GN=gloB PE=3 SV=1 41 260 3.0E-23
sp|Q7VM19|GLO2_HAEDU Hydroxyacylglutathione hydrolase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=gloB PE=3 SV=1 44 257 3.0E-23
sp|A1WXD9|GLO2_HALHL Hydroxyacylglutathione hydrolase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=gloB PE=3 SV=1 41 262 3.0E-23
sp|A8GA75|GLO2_SERP5 Hydroxyacylglutathione hydrolase OS=Serratia proteamaculans (strain 568) GN=gloB PE=3 SV=1 28 283 3.0E-23
sp|Q6LN63|GLO2_PHOPR Hydroxyacylglutathione hydrolase OS=Photobacterium profundum GN=gloB PE=3 SV=2 28 283 4.0E-23
sp|Q0BMS2|GLO2_FRATO Hydroxyacylglutathione hydrolase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=gloB PE=3 SV=1 42 283 4.0E-23
sp|Q2A4E2|GLO2_FRATH Hydroxyacylglutathione hydrolase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=gloB PE=3 SV=1 42 283 4.0E-23
sp|A7NB16|GLO2_FRATF Hydroxyacylglutathione hydrolase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=gloB PE=3 SV=1 42 283 4.0E-23
sp|A4IWV0|GLO2_FRATW Hydroxyacylglutathione hydrolase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=gloB PE=3 SV=1 42 283 4.0E-23
sp|Q5NF43|GLO2_FRATT Hydroxyacylglutathione hydrolase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=gloB PE=3 SV=1 42 283 4.0E-23
sp|B2SFR3|GLO2_FRATM Hydroxyacylglutathione hydrolase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=gloB PE=3 SV=1 42 283 4.0E-23
sp|Q14GJ6|GLO2_FRAT1 Hydroxyacylglutathione hydrolase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=gloB PE=3 SV=1 42 283 4.0E-23
sp|Q3KE79|GLO2_PSEPF Hydroxyacylglutathione hydrolase OS=Pseudomonas fluorescens (strain Pf0-1) GN=gloB PE=3 SV=1 28 283 5.0E-23
sp|B0TXY0|GLO2_FRAP2 Hydroxyacylglutathione hydrolase OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=gloB PE=3 SV=1 42 283 5.0E-23
sp|Q6ML19|GLO2_BDEBA Hydroxyacylglutathione hydrolase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=gloB PE=3 SV=1 29 222 5.0E-23
sp|A6VNK4|GLO2_ACTSZ Hydroxyacylglutathione hydrolase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=gloB PE=3 SV=1 56 258 6.0E-23
sp|Q82XW0|GLO2_NITEU Hydroxyacylglutathione hydrolase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=gloB PE=3 SV=1 41 284 8.0E-23
sp|Q9CMW8|GLO2_PASMU Hydroxyacylglutathione hydrolase OS=Pasteurella multocida (strain Pm70) GN=gloB PE=3 SV=1 42 259 8.0E-23
sp|A0Q7M7|GLO2_FRATN Hydroxyacylglutathione hydrolase OS=Francisella tularensis subsp. novicida (strain U112) GN=gloB PE=3 SV=1 42 283 1.0E-22
sp|Q2SJ47|GLO2_HAHCH Hydroxyacylglutathione hydrolase OS=Hahella chejuensis (strain KCTC 2396) GN=gloB PE=3 SV=1 41 263 1.0E-22
sp|B0BTR9|GLO2_ACTPJ Hydroxyacylglutathione hydrolase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=gloB PE=3 SV=1 28 257 1.0E-22
sp|B3H0S9|GLO2_ACTP7 Hydroxyacylglutathione hydrolase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=gloB PE=3 SV=1 28 257 1.0E-22
sp|A3MZD3|GLO2_ACTP2 Hydroxyacylglutathione hydrolase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=gloB PE=3 SV=1 28 257 1.0E-22
sp|Q4KBH9|GLO2_PSEF5 Hydroxyacylglutathione hydrolase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=gloB PE=3 SV=1 28 283 2.0E-22
sp|Q493H8|GLO2_BLOPB Hydroxyacylglutathione hydrolase OS=Blochmannia pennsylvanicus (strain BPEN) GN=gloB PE=3 SV=1 28 283 2.0E-22
sp|B4SLN7|GLO2_STRM5 Hydroxyacylglutathione hydrolase OS=Stenotrophomonas maltophilia (strain R551-3) GN=gloB PE=3 SV=1 40 284 1.0E-21
sp|Q12MM2|GLO2_SHEDO Hydroxyacylglutathione hydrolase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=gloB PE=3 SV=1 28 283 1.0E-21
sp|A8H589|GLO2_SHEPA Hydroxyacylglutathione hydrolase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=gloB PE=3 SV=1 51 283 2.0E-21
sp|Q21J46|GLO2_SACD2 Hydroxyacylglutathione hydrolase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=gloB PE=3 SV=1 30 283 2.0E-21
sp|Q051W5|GLO2_LEPBL Hydroxyacylglutathione hydrolase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=gloB PE=3 SV=1 42 283 2.0E-21
sp|Q04RQ6|GLO2_LEPBJ Hydroxyacylglutathione hydrolase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=gloB PE=3 SV=1 42 283 2.0E-21
sp|Q08889|GLO2_BUCAP Hydroxyacylglutathione hydrolase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=gloB PE=3 SV=1 41 283 7.0E-21
sp|Q1LT01|GLO2_BAUCH Hydroxyacylglutathione hydrolase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=gloB PE=3 SV=1 28 284 1.0E-20
sp|Q7VQB7|GLO2_BLOFL Hydroxyacylglutathione hydrolase OS=Blochmannia floridanus GN=gloB PE=3 SV=1 37 262 2.0E-20
sp|B0UU01|GLO2_HISS2 Hydroxyacylglutathione hydrolase OS=Histophilus somni (strain 2336) GN=gloB PE=3 SV=1 35 259 2.0E-20
sp|Q0I3Q7|GLO2_HAES1 Hydroxyacylglutathione hydrolase OS=Haemophilus somnus (strain 129Pt) GN=gloB PE=3 SV=1 35 256 3.0E-20
sp|B2FR57|GLO2_STRMK Hydroxyacylglutathione hydrolase OS=Stenotrophomonas maltophilia (strain K279a) GN=gloB PE=3 SV=1 28 284 3.0E-20
sp|C3K9Q0|GLO2_PSEFS Hydroxyacylglutathione hydrolase OS=Pseudomonas fluorescens (strain SBW25) GN=gloB PE=3 SV=1 28 283 9.0E-20
sp|Q4QJZ3|GLO2_HAEI8 Hydroxyacylglutathione hydrolase OS=Haemophilus influenzae (strain 86-028NP) GN=gloB PE=3 SV=1 35 254 1.0E-18
sp|Q65U07|GLO2_MANSM Hydroxyacylglutathione hydrolase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=gloB PE=3 SV=1 70 257 4.0E-18
sp|Q89AN4|GLO2_BUCBP Hydroxyacylglutathione hydrolase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=gloB PE=3 SV=1 41 268 5.0E-18
sp|P71374|GLO2_HAEIN Hydroxyacylglutathione hydrolase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=gloB PE=3 SV=1 81 254 7.0E-18
sp|O95571|ETHE1_HUMAN Persulfide dioxygenase ETHE1, mitochondrial OS=Homo sapiens GN=ETHE1 PE=1 SV=2 35 222 8.0E-18
sp|A5UF43|GLO2_HAEIG Hydroxyacylglutathione hydrolase OS=Haemophilus influenzae (strain PittGG) GN=gloB PE=3 SV=1 35 223 9.0E-18
sp|Q8D3D4|GLO2_WIGBR Hydroxyacylglutathione hydrolase OS=Wigglesworthia glossinidia brevipalpis GN=gloB PE=3 SV=1 41 283 6.0E-17
sp|A7Z4X7|BAEB_BACMF Probable polyketide biosynthesis zinc-dependent hydrolase BaeB OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=baeB PE=1 SV=1 30 221 2.0E-16
sp|A5FZE9|GLO2_ACICJ Hydroxyacylglutathione hydrolase OS=Acidiphilium cryptum (strain JF-5) GN=gloB PE=3 SV=1 81 259 7.0E-16
sp|Q3T094|ETHE1_BOVIN Persulfide dioxygenase ETHE1, mitochondrial OS=Bos taurus GN=ETHE1 PE=2 SV=1 42 207 9.0E-16
sp|Q9DCM0|ETHE1_MOUSE Persulfide dioxygenase ETHE1, mitochondrial OS=Mus musculus GN=Ethe1 PE=1 SV=2 35 207 1.0E-15
sp|O67893|Y2135_AQUAE Uncharacterized protein aq_2135 OS=Aquifex aeolicus (strain VF5) GN=aq_2135 PE=3 SV=1 28 205 2.0E-15
sp|Q0VBY3|HAGHL_BOVIN Hydroxyacylglutathione hydrolase-like protein OS=Bos taurus GN=HAGHL PE=2 SV=1 28 173 3.0E-15
sp|Q9C8L4|ETHE1_ARATH Persulfide dioxygenase ETHE1 homolog, mitochondrial OS=Arabidopsis thaliana GN=GLY3 PE=1 SV=3 35 221 3.0E-15
sp|Q7MQ55|GLO21_VIBVY Hydroxyacylglutathione hydrolase 1 OS=Vibrio vulnificus (strain YJ016) GN=gloB1 PE=3 SV=1 41 282 3.0E-15
sp|P96981|GLO2_RHOCA Hydroxyacylglutathione hydrolase OS=Rhodobacter capsulatus GN=gloB PE=3 SV=1 127 283 5.0E-15
sp|Q2IJC6|GLO2_ANADE Hydroxyacylglutathione hydrolase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=gloB PE=3 SV=1 41 260 9.0E-15
sp|Q49649|Y493_MYCLE Uncharacterized protein ML0493 OS=Mycobacterium leprae (strain TN) GN=ML0493 PE=3 SV=1 45 205 6.0E-14
sp|O34769|PKSB_BACSU Probable polyketide biosynthesis zinc-dependent hydrolase PksB OS=Bacillus subtilis (strain 168) GN=pksB PE=1 SV=1 42 210 1.0E-11
sp|P75849|YCBL_ECOLI Uncharacterized protein YcbL OS=Escherichia coli (strain K12) GN=ycbL PE=3 SV=1 28 205 1.0E-10
sp|P64262|Y2612_MYCBO Uncharacterized protein Mb2612c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb2612c PE=3 SV=1 45 205 6.0E-10
sp|P9WMW3|Y2581_MYCTU Uncharacterized protein Rv2581c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2581c PE=1 SV=1 45 205 6.0E-10
sp|P9WMW2|Y2581_MYCTO Uncharacterized protein MT2658 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2658 PE=3 SV=1 45 205 6.0E-10
sp|Q57544|Y1663_HAEIN Uncharacterized protein HI_1663 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1663 PE=3 SV=1 28 205 4.0E-08
sp|Q53H82|LACB2_HUMAN Beta-lactamase-like protein 2 OS=Homo sapiens GN=LACTB2 PE=1 SV=2 17 205 1.0E-07
sp|Q1LZ83|LACB2_BOVIN Beta-lactamase-like protein 2 OS=Bos taurus GN=LACTB2 PE=2 SV=1 17 229 3.0E-07
sp|Q58298|Y888_METJA Probable metallo-hydrolase MJ0888 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0888 PE=3 SV=1 44 219 3.0E-07
sp|Q561R9|LACB2_RAT Beta-lactamase-like protein 2 OS=Rattus norvegicus GN=Lactb2 PE=2 SV=1 17 205 1.0E-06
sp|Q99KR3|LACB2_MOUSE Beta-lactamase-like protein 2 OS=Mus musculus GN=Lactb2 PE=1 SV=1 17 205 2.0E-06
sp|Q6NYF0|LACB2_DANRE Beta-lactamase-like protein 2 OS=Danio rerio GN=lactb2 PE=2 SV=1 17 205 5.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|2868
MNCFPAIRPLLTQKLLVSRVTSAATRAMHIKTIPMWVGTGNNYSYLVVDDKSKHAVIIDPANAPEVAPVLKEAIS
AGQICLTAIVNTHHHWDHAGGNKALLEELGNPYLDIIGGKDCDGVTKKPVNGQMLKLGDIFIKAIHTPCHTQDSI
CFYMEDMTGRVVFTGDTLFISGCGKFFEGSAAEMHEALNRRLAALPDDTVVYPGHEYTKSNVKFTSSVLQNEAVR
RLHEFAEQNQETTGKFTIGDEKKHNAFMRVDDPEIHKITGASDPVTVMGKLREMKNSFKPPEEKL*
Coding >OphauB2|2868
ATGAATTGCTTCCCTGCCATCAGGCCACTTTTGACGCAAAAGCTCCTTGTCTCGCGTGTAACCTCGGCCGCCACT
CGCGCCATGCACATCAAGACGATCCCCATGTGGGTTGGGACTGGCAACAACTATTCCTACCTCGTCGTCGATGAC
AAATCCAAGCACGCCGTCATTATCGATCCTGCAAATGCCCCTGAAGTGGCGCCCGTACTCAAGGAGGCCATCAGT
GCAGGGCAAATCTGCTTGACGGCCATTGTCAACACGCACCATCACTGGGACCATGCTGGCGGAAACAAGGCCTTG
CTGGAGGAATTAGGCAACCCGTACCTAGACATTATTGGCGGCAAGGACTGTGATGGGGTCACCAAGAAGCCGGTC
AACGGCCAAATGCTCAAACTGGGTGACATTTTTATAAAGGCTATTCACACGCCTTGTCATACGCAGGACAGCATT
TGCTTCTACATGGAAGACATGACAGGACGGGTAGTCTTTACCGGCGACACGCTATTCATTAGCGGTTGCGGCAAG
TTCTTTGAGGGCTCGGCAGCAGAGATGCACGAGGCTCTCAACAGGCGTTTGGCAGCTCTGCCGGATGACACAGTA
GTATACCCAGGACACGAATACACAAAGTCGAATGTCAAGTTTACCTCATCGGTGCTGCAGAATGAGGCGGTGCGC
AGACTACACGAATTTGCAGAACAGAATCAAGAGACGACGGGCAAATTTACCATTGGCGATGAAAAGAAGCACAAC
GCCTTCATGCGAGTTGATGATCCTGAAATCCACAAGATCACAGGCGCATCAGATCCCGTCACCGTCATGGGCAAG
CTACGCGAGATGAAGAATAGCTTCAAGCCGCCCGAGGAAAAATTATGA
Transcript >OphauB2|2868
ATGAATTGCTTCCCTGCCATCAGGCCACTTTTGACGCAAAAGCTCCTTGTCTCGCGTGTAACCTCGGCCGCCACT
CGCGCCATGCACATCAAGACGATCCCCATGTGGGTTGGGACTGGCAACAACTATTCCTACCTCGTCGTCGATGAC
AAATCCAAGCACGCCGTCATTATCGATCCTGCAAATGCCCCTGAAGTGGCGCCCGTACTCAAGGAGGCCATCAGT
GCAGGGCAAATCTGCTTGACGGCCATTGTCAACACGCACCATCACTGGGACCATGCTGGCGGAAACAAGGCCTTG
CTGGAGGAATTAGGCAACCCGTACCTAGACATTATTGGCGGCAAGGACTGTGATGGGGTCACCAAGAAGCCGGTC
AACGGCCAAATGCTCAAACTGGGTGACATTTTTATAAAGGCTATTCACACGCCTTGTCATACGCAGGACAGCATT
TGCTTCTACATGGAAGACATGACAGGACGGGTAGTCTTTACCGGCGACACGCTATTCATTAGCGGTTGCGGCAAG
TTCTTTGAGGGCTCGGCAGCAGAGATGCACGAGGCTCTCAACAGGCGTTTGGCAGCTCTGCCGGATGACACAGTA
GTATACCCAGGACACGAATACACAAAGTCGAATGTCAAGTTTACCTCATCGGTGCTGCAGAATGAGGCGGTGCGC
AGACTACACGAATTTGCAGAACAGAATCAAGAGACGACGGGCAAATTTACCATTGGCGATGAAAAGAAGCACAAC
GCCTTCATGCGAGTTGATGATCCTGAAATCCACAAGATCACAGGCGCATCAGATCCCGTCACCGTCATGGGCAAG
CTACGCGAGATGAAGAATAGCTTCAAGCCGCCCGAGGAAAAATTATGA
Gene >OphauB2|2868
ATGAATTGCTTCCCTGCCATCAGGCCACTTTTGACGCAAAAGCTCCTTGTCTCGCGTGTAACCGTGAGTTGAGCC
GACTTGTCAGATTTGGCCATTCCTCAGCCATGCTAACCGTGGCCTCAAGTCGGCCGCCACTCGCGCCATGCACAT
CAAGACGATCCCCATGTGTATGTGACATTCCGTTCGGCCGCTATTTGCCCGTCATGATGCCTCATCTCTCTGACC
TGGTCCCACCTTGTAGGGGTTGGGACTGGCAACAACTATTCCTACCTCGTCGTCGATGACAAATCCAAGCACGCC
GTCATTATCGATCCTGCAAATGCCCCTGAGTAGGTTGCCACGTTGAGCCATGAGAGAAGAGGGAATCATGCACTG
ACCCTGATGGGGGTGGCAACCTGAGAGCAGAGTGGCGCCCGTACTCAAGGAGGCCATCAGTGCAGGGCAAATCTG
CTTGACGGCCATTGTCAACACGCACCAGTAAGTGTCAGGCCGAGAGGGTGGCGTGTAGAGATGGAGGCGTCTTGA
GACGTGGCATCGAGACATCTAACAGCCCGAGGCAGTCACTGGGACCATGCTGGCGGAAACAAGGCCTTGGTACGT
AGTAGTACTCCCTTTCAAGCCTCCAACAATGGTGACTATAATTTTGCCAGCCATGGCTAACCCCTTAGGCAGCTG
GAGGAATTAGGCAACCCGTACCTAGACATTATTGGCGGCAAGGACTGTGATGGGGTCACCAAGAAGCCGGTCAAC
GGCCAAATGCTCAAACTGGGTGACATTTTTATAAAGGCTATTCACACGCCTTGTCATACGCAGGACAGCATTTGC
TTCTACATGGAAGACATGACAGGACGGGTAGTCTTTACCGGCGACACGCTATTCATTAGCGGTACAGTTTTCTCC
AAGGGCTGCTTTTTATGACGCATGGACTCTGCTGATGAGTCCGGCATCAGGTTGCGGCAAGTTCTTTGAGGGCTC
GGCAGCAGAGATGCACGAGGCTCTCAACAGGCGTTTGGCAGCTCTGCCGGATGACACAGTAGTATACGTGAGGCT
GCCTCTGAGGGCAAATAGCAAAACTCCGGGCATGCCTGCTGACTCGTGTGTGCTTGTTGTTGTTTTTTACAGCCA
GGACACGAATACACAAAGTCGAATGTCAAGTTTACCTCATCGGTGCTGCAGAATGAGGCGGTGCGCAGACTACAC
GAATTTGCAGAACAGAATCAAGAGACGACGGGCAAATTTACCATTGGCGATGAAAAGGTGCGCAATGATTTGCAT
AGGAGACTTTGTGGAACCATCTGACGCTTAGTCGTTTATTGCTCGCATCAGAAGCACAACGCCTTCATGCGAGTT
GATGTAAGTTTGGATCCCTTGAGCCACAGACATGGCATGACTGATACTTGGCTGCGGGGCAGGATCCTGAAATCC
ACAAGATCACAGGCGCATCAGATCCCGTCACCGTCATGGGCAAGCTACGCGAGATGAAGAATAGCTTCAAGTGAG
GACTGGCACCATTTTGGTTGCTGTGCTGTTGCTGTTGACATAATTCTTACCCCAGGCCGCCCGAGGAAAAATTAT
GA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail